new BindingDB logo
myBDB logout
Compile Data Set for Download or QSAR

Found 104 hits with Last Name = 'pruess' and Initial = 'th'   
Target/Host
(Institution)
LigandTarget/Host
Links
Ligand
Links
Trg + Lig
Links
Ki
nM
ΔG°
kJ/mole
IC50
nM
Kd
nM
EC50/IC50
nM
koff
s-1
kon
M-1s-1
pHTemp
°C
GALR1


(Homo sapiens (Human))
BDBM50273370
PNG
((2S)-2-[(2S)-2-[(2S,3R)-2-[(2S)-2-(2-aminoacetamid...)
Show SMILES CC(C)C[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)CN)[C@@H](C)O)C(=O)NCC(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CO)C(=O)N1CCC[C@H]1C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CCCN=C(N)N)C(N)=O |r,wU:106.112,4.4,8.12,32.33,37.40,43.48,51.56,63.76,wD:149.157,138.145,134.142,125.131,114.119,99.104,92.96,16.25,59.60,79.83,(16.53,-9.13,;15.19,-9.9,;15.2,-11.44,;13.86,-9.13,;12.52,-9.9,;11.19,-9.13,;11.19,-7.59,;12.53,-6.82,;9.86,-6.82,;9.86,-5.28,;11.2,-4.51,;12.52,-5.28,;11.2,-2.97,;8.13,-7.82,;6.39,-6.82,;6.39,-5.28,;4.66,-7.83,;4.66,-9.36,;5.99,-10.13,;5.99,-11.67,;7.32,-12.44,;8.66,-11.67,;9.99,-12.44,;8.66,-10.13,;7.33,-9.36,;2.92,-6.82,;2.92,-5.28,;4.26,-4.52,;1.19,-4.28,;1.19,-2.75,;2.52,-1.97,;3.86,-2.74,;2.52,-.43,;3.86,.34,;1.2,.34,;1.19,1.88,;2.53,2.65,;-.14,2.65,;-.14,4.19,;1.19,4.96,;-1.48,1.88,;-2.81,2.65,;-2.81,4.19,;-4.14,1.88,;-5.48,2.64,;-5.47,4.19,;-6.81,4.96,;-4.14,4.96,;-4.15,.34,;-5.48,-.43,;-6.81,.34,;-5.48,-1.97,;-6.81,-2.74,;-8.14,-1.97,;-8.14,-.43,;-9.47,-2.74,;-4.14,-2.74,;-4.14,-4.28,;-5.48,-5.05,;-2.81,-5.05,;-2.81,-6.59,;-1.48,-7.36,;-.15,-6.59,;-1.48,-8.9,;-2.85,-9.59,;-4.14,-8.76,;-4.22,-7.22,;-5.71,-6.82,;-6.55,-8.12,;-8.07,-8.35,;-8.62,-9.79,;-7.65,-10.99,;-6.13,-10.75,;-5.58,-9.31,;-.14,-9.67,;1.19,-8.9,;1.19,-7.36,;2.53,-9.67,;2.53,-11.21,;-1.47,-4.28,;-.15,-5.05,;-1.47,-2.74,;12.53,-11.44,;13.86,-12.21,;11.19,-12.21,;11.19,-13.75,;12.53,-14.52,;13.86,-13.75,;12.53,-16.06,;11.28,-16.96,;11.76,-18.43,;13.29,-18.43,;13.77,-16.97,;15.24,-16.49,;15.64,-15,;16.65,-17.91,;16.41,-19.42,;17.78,-20.13,;18.87,-19.04,;18.18,-17.67,;19.08,-15.88,;20.62,-15.8,;18.31,-14.55,;16.78,-14.38,;16.46,-12.88,;17.8,-12.12,;18.94,-13.14,;20.31,-12.44,;21.65,-13.21,;20.31,-10.9,;21.64,-10.13,;22.97,-10.89,;24.3,-10.12,;22.98,-12.43,;24.31,-13.2,;24.32,-14.74,;25.65,-15.5,;25.66,-17.04,;26.99,-17.81,;28.33,-17.04,;28.32,-15.5,;26.99,-14.73,;25.64,-12.43,;25.64,-10.89,;26.98,-13.19,;28.31,-12.42,;29.65,-13.18,;30.98,-12.41,;28.31,-10.88,;26.97,-10.11,;29.64,-10.1,;31.05,-10.72,;32.07,-9.57,;31.3,-8.24,;29.8,-8.57,;28.51,-7.72,;27.17,-8.47,;28.53,-6.17,;29.88,-5.42,;31.2,-6.21,;32.54,-5.45,;32.56,-3.91,;33.91,-3.16,;35.23,-3.95,;35.21,-5.49,;33.87,-6.24,;29.9,-3.88,;31.24,-3.12,;28.57,-3.1,;28.59,-1.55,;29.93,-.8,;29.95,.74,;28.63,1.53,;28.65,3.07,;29.99,3.82,;30.01,5.36,;31.32,3.03,;27.27,-.77,;27.29,.77,;25.92,-1.52,)|
Show InChI InChI=1S/C107H153N27O26/c1-57(2)42-70(123-93(147)71(43-58(3)4)124-95(149)74(47-64-33-35-66(138)36-34-64)121-86(141)52-115-91(145)60(7)118-100(154)78(55-135)128-98(152)77(49-84(109)139)125-94(148)72(44-59(5)6)127-103(157)89(61(8)137)130-99(153)76(119-85(140)50-108)48-65-51-114-68-27-16-15-26-67(65)68)92(146)117-54-88(143)131-38-20-31-82(131)105(159)134-41-21-32-83(134)106(160)133-40-18-29-80(133)101(155)116-53-87(142)120-73(45-62-22-11-9-12-23-62)96(150)129-79(56-136)104(158)132-39-19-30-81(132)102(156)126-75(46-63-24-13-10-14-25-63)97(151)122-69(90(110)144)28-17-37-113-107(111)112/h9-16,22-27,33-36,51,57-61,69-83,89,114,135-138H,17-21,28-32,37-50,52-56,108H2,1-8H3,(H2,109,139)(H2,110,144)(H,115,145)(H,116,155)(H,117,146)(H,118,154)(H,119,140)(H,120,142)(H,121,141)(H,122,151)(H,123,147)(H,124,149)(H,125,148)(H,126,156)(H,127,157)(H,128,152)(H,129,150)(H,130,153)(H4,111,112,113)/t60-,61+,69-,70-,71-,72-,73-,74-,75-,76-,77-,78-,79-,80-,81-,82-,83-,89-/m0/s1
Reactome pathway
KEGG

UniProtKB/SwissProt

antibodypedia
GoogleScholar
AffyNet 
CHEMBL
PC cid
PC sid
UniChem
Article
PubMed
0.0100n/an/an/an/an/an/an/an/a



University of Utah

Curated by ChEMBL


Assay Description
Binding affinity to human GalR1


J Med Chem 53: 1871-5 (2010)


Article DOI: 10.1021/jm9018349
BindingDB Entry DOI: 10.7270/Q26D5TXJ
More data for this
Ligand-Target Pair
GALR1


(Homo sapiens (Human))
BDBM50378616
PNG
(GALANIN)
Show SMILES CC[C@H](C)[C@H](NC(=O)[C@H](C)NC(=O)[C@H](Cc1cnc[nH]1)NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)CN)[C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](Cc1cnc[nH]1)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CO)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](Cc1cnc[nH]1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(N)=O |r,wU:119.123,135.139,162.167,173.179,200.207,224.233,13.20,42.48,50.61,113.119,93.96,wD:2.2,127.131,145.150,156.161,183.190,191.198,216.224,4.4,8.8,23.23,34.40,66.69,71.76,77.84,85.92,97.112,(19.04,-36.25,;18.27,-34.92,;16.73,-34.92,;15.96,-36.25,;15.96,-33.59,;14.42,-33.59,;13.65,-34.92,;14.42,-36.25,;12.11,-34.92,;11.34,-36.25,;11.34,-33.59,;9.8,-33.59,;9.03,-34.92,;9.03,-32.26,;9.8,-30.92,;9.03,-29.59,;9.66,-28.19,;8.52,-27.16,;7.18,-27.92,;7.5,-29.43,;7.49,-32.26,;6.72,-33.59,;7.49,-34.92,;5.19,-33.67,;4.35,-34.96,;2.86,-34.56,;2.78,-33.03,;4.21,-32.48,;4.62,-30.99,;6.1,-30.59,;3.53,-29.9,;2.04,-30.3,;.95,-29.21,;-.53,-29.61,;1.35,-27.72,;.26,-26.63,;-1.23,-27.03,;-2.31,-25.94,;-1.62,-28.52,;2.83,-27.32,;3.24,-25.83,;2.15,-24.75,;4.72,-25.44,;5.81,-26.53,;5.41,-28.01,;3.93,-28.41,;6.5,-29.11,;5.24,-23.51,;3.83,-22.09,;2.34,-22.49,;4.34,-20.16,;5.83,-19.76,;6.92,-20.85,;8.4,-20.45,;9.5,-21.54,;9.09,-23.02,;10.19,-24.11,;7.61,-23.42,;6.52,-22.33,;2.93,-18.75,;1.44,-19.14,;1.04,-20.63,;.03,-17.72,;-1.46,-18.12,;-1.86,-19.61,;-.77,-20.7,;-3.35,-20.01,;-3.75,-21.5,;-4.43,-18.92,;-5.93,-19.32,;-6.32,-20.81,;-7.01,-18.23,;-8.5,-18.63,;-8.9,-20.12,;-6.61,-16.74,;-7.7,-15.65,;-9.19,-16.05,;-7.3,-14.17,;-8.39,-13.08,;-9.88,-13.47,;-10.97,-12.39,;-10.28,-14.97,;-5.82,-13.77,;-5.42,-12.28,;-6.51,-11.19,;-3.93,-11.88,;-3.53,-10.4,;-4.62,-9.31,;-6.11,-9.71,;-4.22,-7.82,;-2.84,-12.97,;-1.35,-12.57,;-.95,-11.09,;-.27,-13.66,;1.22,-13.27,;2.31,-14.35,;1.91,-15.84,;3.79,-13.96,;4.12,-12.45,;5.58,-11.97,;6.06,-10.51,;7.59,-10.51,;8.07,-11.97,;9.48,-12.6,;9.64,-14.13,;8.39,-15.04,;6.99,-14.41,;6.82,-12.88,;4.89,-15.04,;4.49,-16.53,;3,-16.93,;5.58,-17.62,;7.06,-17.22,;-.66,-15.15,;.43,-16.24,;-2.15,-15.55,;16.73,-32.26,;18.27,-32.26,;15.96,-30.92,;16.73,-29.59,;15.96,-28.26,;14.42,-28.26,;13.65,-29.59,;13.65,-26.93,;18.27,-29.59,;19.04,-28.26,;19.04,-30.92,;20.57,-30.92,;21.35,-32.26,;22.88,-32.26,;23.66,-33.59,;23.66,-30.92,;21.35,-29.59,;22.88,-29.59,;20.57,-28.26,;21.35,-26.93,;20.57,-25.59,;21.35,-24.26,;20.72,-22.86,;21.87,-21.82,;23.2,-22.59,;22.88,-24.09,;22.88,-26.93,;23.66,-28.26,;23.66,-25.59,;25.19,-25.59,;25.97,-26.93,;27.5,-26.93,;28.27,-25.59,;29.81,-25.59,;30.58,-24.26,;32.12,-24.26,;29.81,-22.92,;25.97,-24.26,;27.5,-24.26,;25.19,-22.92,;25.97,-21.59,;27.5,-21.59,;28.27,-20.26,;25.19,-20.26,;25.97,-18.92,;23.66,-20.26,;22.88,-18.92,;21.35,-18.92,;20.57,-17.59,;19.04,-17.59,;18.27,-16.26,;19.04,-14.93,;20.57,-14.93,;21.35,-16.26,;23.66,-17.59,;25.19,-17.59,;22.88,-16.26,;23.66,-14.93,;22.88,-13.59,;23.66,-12.26,;23.03,-10.86,;24.18,-9.82,;25.51,-10.59,;25.19,-12.1,;25.19,-14.93,;25.97,-16.26,;25.97,-13.59,;27.5,-13.59,;28.27,-14.93,;29.81,-14.93,;30.58,-16.26,;30.58,-13.59,;28.27,-12.26,;29.81,-12.26,;27.5,-10.93,;28.27,-9.6,;29.81,-9.6,;30.58,-10.93,;32.12,-10.93,;32.89,-12.26,;34.43,-12.26,;27.5,-8.26,;28.27,-6.92,;25.97,-8.26,;25.19,-6.92,;23.66,-6.92,;22.88,-5.59,;21.35,-5.59,;20.57,-4.26,;21.35,-2.93,;20.57,-1.59,;22.88,-2.93,;23.66,-4.26,;25.97,-5.59,;27.5,-5.59,;25.19,-4.26,;25.97,-2.93,;27.5,-2.93,;28.27,-4.26,;28.27,-1.59,;29.81,-1.59,;30.58,-2.93,;32.12,-2.93,;32.89,-4.26,;32.89,-1.59,;30.58,-.26,;32.12,-.26,;29.81,1.07,;30.58,2.4,;29.81,3.74,;32.12,2.4,;32.89,3.74,;32.89,1.07,)|
Show InChI InChI=1S/C146H213N43O40/c1-15-75(10)119(187-123(207)78(13)167-129(213)101(51-84-60-154-68-162-84)182-143(227)110-31-24-42-189(110)116(200)65-161-124(208)93(43-71(2)3)173-130(214)95(45-73(6)7)174-132(216)98(49-82-34-38-88(194)39-35-82)170-114(198)63-159-122(206)77(12)166-141(225)108(66-190)186-137(221)105(55-112(150)196)179-131(215)96(46-74(8)9)183-145(229)120(79(14)192)188-140(224)100(168-113(197)58-148)50-83-59-158-90-28-20-19-27-89(83)90)144(228)184-107(57-118(203)204)139(223)180-104(54-111(149)195)136(220)178-102(52-85-61-155-69-163-85)134(218)172-92(30-23-41-157-146(152)153)127(211)185-109(67-191)142(226)176-99(47-80-25-17-16-18-26-80)133(217)177-103(53-86-62-156-70-164-86)135(219)181-106(56-117(201)202)138(222)171-91(29-21-22-40-147)126(210)175-97(48-81-32-36-87(193)37-33-81)125(209)160-64-115(199)169-94(44-72(4)5)128(212)165-76(11)121(151)205/h16-20,25-28,32-39,59-62,68-79,91-110,119-120,158,190-194H,15,21-24,29-31,40-58,63-67,147-148H2,1-14H3,(H2,149,195)(H2,150,196)(H2,151,205)(H,154,162)(H,155,163)(H,156,164)(H,159,206)(H,160,209)(H,161,208)(H,165,212)(H,166,225)(H,167,213)(H,168,197)(H,169,199)(H,170,198)(H,171,222)(H,172,218)(H,173,214)(H,174,216)(H,175,210)(H,176,226)(H,177,217)(H,178,220)(H,179,215)(H,180,223)(H,181,219)(H,182,227)(H,183,229)(H,184,228)(H,185,211)(H,186,221)(H,187,207)(H,188,224)(H,201,202)(H,203,204)(H4,152,153,157)/t75-,76-,77-,78-,79+,91-,92-,93-,94-,95-,96-,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,108-,109-,110-,119-,120-/m0/s1
Reactome pathway
KEGG

UniProtKB/SwissProt

antibodypedia
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
Article
PubMed
0.0300n/an/an/an/an/an/an/an/a



University of Utah

Curated by ChEMBL


Assay Description
Binding affinity to human GalR1


J Med Chem 53: 1871-5 (2010)


Article DOI: 10.1021/jm9018349
BindingDB Entry DOI: 10.7270/Q26D5TXJ
More data for this
Ligand-Target Pair
GALR1


(Homo sapiens (Human))
BDBM50273369
PNG
(CHEMBL526003 | GWTLNSAGYLLGPQQFFGLM-CONH2 | Galani...)
Show SMILES CSCC[C@H](NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)CN)[C@@H](C)O)C(N)=O |r|
Show InChI InChI=1S/C104H151N25O26S/c1-54(2)39-70(91(142)113-52-87(139)129-37-20-27-80(129)103(154)120-69(33-35-82(107)134)93(144)119-68(32-34-81(106)133)94(145)124-76(44-61-23-16-13-17-24-61)99(150)123-74(43-60-21-14-12-15-22-60)92(143)112-51-86(138)116-71(40-55(3)4)95(146)118-67(89(109)140)36-38-156-11)121-96(147)72(41-56(5)6)122-98(149)75(45-62-28-30-64(132)31-29-62)117-85(137)50-111-90(141)58(9)114-102(153)79(53-130)127-100(151)78(47-83(108)135)125-97(148)73(42-57(7)8)126-104(155)88(59(10)131)128-101(152)77(115-84(136)48-105)46-63-49-110-66-26-19-18-25-65(63)66/h12-19,21-26,28-31,49,54-59,67-80,88,110,130-132H,20,27,32-48,50-53,105H2,1-11H3,(H2,106,133)(H2,107,134)(H2,108,135)(H2,109,140)(H,111,141)(H,112,143)(H,113,142)(H,114,153)(H,115,136)(H,116,138)(H,117,137)(H,118,146)(H,119,144)(H,120,154)(H,121,147)(H,122,149)(H,123,150)(H,124,145)(H,125,148)(H,126,155)(H,127,151)(H,128,152)/t58-,59+,67-,68-,69-,70-,71-,72-,73-,74-,75-,76-,77-,78-,79-,80-,88-/m0/s1
Reactome pathway
KEGG

UniProtKB/SwissProt

antibodypedia
GoogleScholar
AffyNet 
Purchase

CHEMBL
PC cid
PC sid
UniChem
Article
PubMed
0.0300n/an/an/an/an/an/an/an/a



University of Utah

Curated by ChEMBL


Assay Description
Binding affinity to human GalR1


J Med Chem 53: 1871-5 (2010)


Article DOI: 10.1021/jm9018349
BindingDB Entry DOI: 10.7270/Q26D5TXJ
More data for this
Ligand-Target Pair
GALR1


(Homo sapiens (Human))
BDBM50307256
PNG
(CHEMBL604373 | GWTLNSAGYLLGPrPKPQQwFwLL-CONH2 | Ga...)
Show SMILES CC(C)C[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCCN)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](CCCN=C(N)N)NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)CN)[C@@H](C)O)C(N)=O |r,wU:181.202,169.182,155.166,150.159,134.151,118.130,107.113,96.110,80.91,64.74,4.4,wD:177.186,197.209,161.174,126.138,89.94,73.77,55.65,41.56,30.40,16.28,8.12,(-10.91,-15.15,;-10.14,-13.82,;-10.9,-12.49,;-8.59,-13.83,;-7.82,-12.49,;-6.29,-12.5,;-5.52,-13.84,;-6.29,-15.17,;-3.97,-13.84,;-3.2,-12.51,;-3.97,-11.17,;-3.19,-9.85,;-5.5,-11.18,;-3.21,-15.18,;-1.67,-15.19,;-.9,-13.86,;-.9,-16.52,;-1.68,-17.86,;-1.62,-19.4,;-.32,-20.25,;-.73,-21.73,;-2.27,-21.8,;-3.25,-22.99,;-4.76,-22.74,;-5.3,-21.3,;-4.34,-20.11,;-2.81,-20.36,;.63,-16.54,;1.4,-17.87,;.62,-19.21,;2.94,-17.88,;3.72,-16.55,;2.94,-15.21,;1.41,-15.2,;.65,-13.86,;1.42,-12.54,;2.96,-12.53,;3.73,-13.87,;3.7,-19.21,;5.25,-19.16,;5.97,-17.8,;6.06,-20.47,;5.33,-21.83,;3.79,-21.88,;2.85,-20.67,;1.4,-21.19,;1.46,-22.73,;.34,-23.8,;.71,-25.29,;2.19,-25.72,;3.3,-24.65,;2.93,-23.16,;7.6,-20.42,;8.41,-21.74,;7.69,-23.08,;9.94,-21.67,;10.68,-20.31,;9.86,-19.01,;10.59,-17.64,;12.12,-17.6,;9.77,-16.33,;10.76,-22.98,;12.31,-22.93,;13.03,-21.57,;13.11,-24.23,;12.39,-25.6,;10.86,-25.65,;10.13,-27.01,;10.94,-28.32,;8.58,-27.06,;14.66,-24.17,;15.38,-22.81,;14.55,-21.5,;16.91,-22.75,;17.56,-21.34,;19.18,-21.81,;19.22,-23.48,;17.65,-24.07,;17.55,-25.6,;16.18,-26.3,;18.85,-26.45,;18.77,-27.98,;17.39,-28.68,;17.29,-30.22,;15.92,-30.91,;15.83,-32.45,;20.22,-25.75,;21.51,-26.6,;21.42,-28.13,;22.89,-25.91,;22.89,-24.35,;24.56,-24.11,;25.29,-25.62,;24.1,-26.8,;24.2,-28.34,;22.93,-29.19,;25.62,-28.92,;26.9,-28.07,;28.28,-28.74,;29.56,-27.88,;30.94,-28.56,;32.23,-27.69,;32.11,-26.16,;33.6,-28.38,;25.82,-30.45,;27.24,-31.05,;28.52,-30.19,;27.44,-32.58,;26.15,-33.45,;26.89,-34.98,;28.55,-34.74,;28.85,-33.08,;30.19,-32.31,;30.19,-30.77,;31.52,-33.08,;31.52,-34.62,;32.86,-35.39,;34.2,-34.61,;32.86,-36.92,;31.52,-37.7,;30.19,-36.92,;28.86,-37.7,;30.19,-35.39,;34.2,-37.7,;34.2,-39.24,;32.86,-40.01,;35.54,-40.01,;36.87,-39.23,;36.87,-37.69,;38.2,-36.92,;35.53,-36.92,;35.54,-41.54,;36.87,-42.31,;36.87,-43.85,;38.2,-41.54,;39.53,-42.32,;39.53,-43.84,;38.22,-44.61,;38.21,-46.16,;39.56,-46.92,;39.56,-48.46,;40.89,-46.14,;40.87,-44.61,;38.2,-39.99,;39.52,-39.23,;40.86,-40,;39.52,-37.69,;40.86,-36.91,;40.86,-35.37,;39.52,-34.61,;42.19,-34.61,;43.53,-35.37,;42.19,-33.07,;43.53,-32.29,;43.53,-30.76,;44.86,-33.06,;44.86,-34.6,;46.19,-35.37,;46.19,-32.28,;47.52,-33.05,;47.52,-34.6,;48.86,-32.28,;48.86,-30.74,;47.52,-29.97,;46.19,-30.74,;47.52,-28.44,;50.19,-33.05,;51.54,-32.29,;51.54,-30.74,;52.86,-33.05,;52.86,-34.59,;51.54,-35.37,;51.54,-36.91,;50.19,-34.59,;54.2,-32.28,;55.53,-33.05,;55.53,-34.59,;56.86,-32.28,;58.19,-33.04,;59.53,-32.27,;59.53,-30.73,;60.86,-33.04,;60.86,-34.58,;59.53,-35.35,;58.13,-34.73,;57.11,-35.88,;57.88,-37.21,;57.4,-38.68,;58.43,-39.82,;59.95,-39.49,;60.41,-38.03,;59.37,-36.89,;62.19,-32.28,;63.53,-33.05,;63.53,-34.58,;64.86,-32.28,;66.19,-33.04,;56.86,-30.74,;58.19,-29.97,;55.53,-29.97,;-8.59,-11.16,;-10.13,-11.15,;-7.81,-9.83,)|
Show InChI InChI=1S/C138H199N35O30/c1-72(2)54-95(117(144)183)160-122(188)97(56-74(5)6)163-127(193)104(63-83-68-150-90-35-21-18-32-87(83)90)166-126(192)101(59-79-28-14-13-15-29-79)164-128(194)103(62-82-67-149-89-34-20-17-31-86(82)89)165-121(187)91(45-47-110(141)177)156-120(186)92(46-48-111(142)178)157-133(199)108-39-26-52-172(108)136(202)93(36-22-23-49-139)158-134(200)109-40-27-53-173(109)137(203)94(37-24-50-147-138(145)146)159-132(198)107-38-25-51-171(107)115(182)70-152-119(185)96(55-73(3)4)161-123(189)98(57-75(7)8)162-125(191)100(60-80-41-43-84(176)44-42-80)155-114(181)69-151-118(184)77(11)153-131(197)106(71-174)169-129(195)105(64-112(143)179)167-124(190)99(58-76(9)10)168-135(201)116(78(12)175)170-130(196)102(154-113(180)65-140)61-81-66-148-88-33-19-16-30-85(81)88/h13-21,28-35,41-44,66-68,72-78,91-109,116,148-150,174-176H,22-27,36-40,45-65,69-71,139-140H2,1-12H3,(H2,141,177)(H2,142,178)(H2,143,179)(H2,144,183)(H,151,184)(H,152,185)(H,153,197)(H,154,180)(H,155,181)(H,156,186)(H,157,199)(H,158,200)(H,159,198)(H,160,188)(H,161,189)(H,162,191)(H,163,193)(H,164,194)(H,165,187)(H,166,192)(H,167,190)(H,168,201)(H,169,195)(H,170,196)(H4,145,146,147)/t77-,78+,91-,92-,93-,94+,95-,96-,97-,98-,99-,100-,101-,102-,103+,104+,105-,106-,107-,108-,109-,116-/m0/s1
Reactome pathway
KEGG

UniProtKB/SwissProt

antibodypedia
GoogleScholar
AffyNet 
CHEMBL
PC cid
PC sid
UniChem
Article
PubMed
0.0800n/an/an/an/an/an/an/an/a



University of Utah

Curated by ChEMBL


Assay Description
Binding affinity to human GalR1


J Med Chem 53: 1871-5 (2010)


Article DOI: 10.1021/jm9018349
BindingDB Entry DOI: 10.7270/Q26D5TXJ
More data for this
Ligand-Target Pair
GALR1


(Homo sapiens (Human))
BDBM50307254
PNG
(CHEMBL604990 | GWTLNSAGYLLGPPPALALA-CONH2 | M40)
Show SMILES CC(C)C[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)CN)[C@@H](C)O)C(=O)NCC(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(N)=O |r|
Show InChI InChI=1S/C94H145N23O24/c1-46(2)33-61(82(129)100-44-76(124)115-30-19-24-71(115)93(140)117-32-20-25-72(117)94(141)116-31-18-23-70(116)91(138)104-54(14)81(128)108-63(35-48(5)6)84(131)103-53(13)80(127)107-62(34-47(3)4)83(130)101-51(11)78(97)125)109-85(132)64(36-49(7)8)110-87(134)66(38-56-26-28-58(120)29-27-56)106-75(123)43-99-79(126)52(12)102-90(137)69(45-118)113-88(135)68(40-73(96)121)111-86(133)65(37-50(9)10)112-92(139)77(55(15)119)114-89(136)67(105-74(122)41-95)39-57-42-98-60-22-17-16-21-59(57)60/h16-17,21-22,26-29,42,46-55,61-72,77,98,118-120H,18-20,23-25,30-41,43-45,95H2,1-15H3,(H2,96,121)(H2,97,125)(H,99,126)(H,100,129)(H,101,130)(H,102,137)(H,103,131)(H,104,138)(H,105,122)(H,106,123)(H,107,127)(H,108,128)(H,109,132)(H,110,134)(H,111,133)(H,112,139)(H,113,135)(H,114,136)/t51-,52-,53-,54-,55+,61-,62-,63-,64-,65-,66-,67-,68-,69-,70-,71-,72-,77-/m0/s1
Reactome pathway
KEGG

UniProtKB/SwissProt

antibodypedia
GoogleScholar
AffyNet 
CHEMBL
PC cid
PC sid
UniChem
Article
PubMed
0.100n/an/an/an/an/an/an/an/a



University of Utah

Curated by ChEMBL


Assay Description
Binding affinity to human GalR1


J Med Chem 53: 1871-5 (2010)


Article DOI: 10.1021/jm9018349
BindingDB Entry DOI: 10.7270/Q26D5TXJ
More data for this
Ligand-Target Pair
GALR1


(Homo sapiens (Human))
BDBM50307255
PNG
(CHEMBL592413 | GWTLNSAGYLLGPRHYINLITRQRY-CONH2)
Show SMILES CC[C@H](C)[C@H](NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](Cc1cnc[nH]1)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)CN)[C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](Cc1ccc(O)cc1)C(N)=O |r,wU:111.115,131.138,95.103,84.88,68.80,52.59,30.39,20.28,8.17,2.2,137.142,153.158,154.161,171.176,191.196,wD:115.131,103.111,89.95,60.67,41.42,4.4,145.150,160.165,180.185,(26.61,-58.6,;26.58,-57.06,;27.89,-56.27,;29.25,-57.01,;27.87,-54.73,;26.53,-53.98,;25.2,-54.77,;25.23,-56.32,;23.86,-54.03,;23.83,-52.49,;25.14,-51.7,;26.49,-52.44,;27.81,-51.64,;27.79,-50.1,;29.1,-49.31,;26.44,-49.36,;25.12,-50.16,;22.54,-54.82,;21.14,-54.17,;19.88,-55.03,;21.03,-52.63,;22.3,-51.76,;22.17,-50.22,;23.34,-49.22,;22.74,-47.8,;21.21,-47.92,;20.86,-49.41,;19.63,-51.97,;18.21,-52.57,;18.02,-54.1,;16.99,-51.63,;17.18,-50.12,;18.6,-49.51,;18.79,-47.98,;20.2,-47.38,;20.4,-45.85,;19.17,-44.92,;21.81,-45.25,;15.57,-52.23,;14.34,-51.31,;14.54,-49.78,;12.94,-51.9,;12.81,-53.46,;11.14,-53.58,;10.5,-52.03,;11.77,-50.93,;11.77,-49.38,;10.41,-48.63,;13.1,-48.63,;13.08,-47.08,;14.42,-46.3,;15.76,-47.07,;14.41,-44.75,;15.73,-43.97,;17.08,-44.75,;18.42,-43.97,;17.1,-46.29,;13.07,-43.99,;13.06,-42.45,;14.39,-41.68,;11.72,-41.69,;10.4,-42.46,;10.4,-44.01,;9.07,-44.77,;11.75,-44.77,;11.73,-40.14,;10.37,-39.39,;9.05,-40.16,;10.38,-37.84,;11.71,-37.07,;13.04,-37.83,;13.06,-39.37,;14.39,-40.13,;15.71,-39.36,;17.06,-40.12,;15.72,-37.82,;14.38,-37.06,;9.03,-37.07,;9.02,-35.54,;10.36,-34.77,;7.68,-34.77,;7.69,-33.24,;6.36,-32.47,;5.02,-33.24,;6.34,-30.93,;7.68,-30.15,;5.01,-30.16,;5,-28.63,;6.32,-27.86,;3.66,-27.86,;2.32,-28.64,;2.35,-30.18,;3.67,-26.33,;2.31,-25.56,;.99,-26.34,;2.3,-24.01,;3.64,-23.23,;4.98,-24,;4.99,-25.56,;6.3,-23.23,;.97,-23.26,;.97,-21.72,;2.29,-20.94,;-.37,-20.95,;-1.7,-21.73,;-1.69,-23.27,;-3.03,-24.05,;-.35,-24.03,;-.37,-19.42,;-1.72,-18.65,;-3.04,-19.43,;-1.72,-17.11,;-3.07,-16.34,;-3.06,-14.81,;-1.75,-14.03,;-4.41,-14.04,;-5.73,-14.82,;-5.73,-16.36,;-4.47,-17.26,;-4.95,-18.72,;-6.5,-18.73,;-7.52,-19.88,;-9.02,-19.57,;-9.5,-18.1,;-8.48,-16.95,;-6.96,-17.27,;-4.41,-12.5,;-5.76,-11.74,;-7.08,-12.51,;-5.76,-10.2,;-7.11,-9.43,;-.4,-16.33,;-.41,-14.79,;.94,-17.09,;29.19,-53.93,;29.17,-52.39,;30.54,-54.67,;31.86,-53.88,;31.83,-52.34,;33.15,-51.55,;34.49,-52.29,;33.13,-50.01,;33.21,-54.62,;33.24,-56.17,;34.53,-53.83,;35.88,-54.58,;35.9,-56.11,;37.25,-56.86,;37.28,-58.4,;38.57,-56.06,;37.2,-53.78,;37.17,-52.24,;38.54,-54.52,;39.87,-53.73,;39.83,-52.18,;38.48,-51.44,;41.15,-51.4,;41.21,-54.47,;41.24,-56.01,;42.53,-53.68,;43.87,-54.42,;43.9,-55.97,;45.25,-56.71,;45.28,-58.25,;46.63,-58.99,;46.66,-60.53,;45.34,-61.32,;48.01,-61.28,;45.2,-53.63,;45.17,-52.08,;46.55,-54.37,;47.86,-53.57,;47.84,-52.03,;49.16,-51.24,;49.13,-49.7,;47.77,-48.95,;50.45,-48.91,;49.22,-54.32,;49.24,-55.86,;50.53,-53.52,;51.88,-54.27,;51.91,-55.81,;53.26,-56.56,;53.28,-58.09,;54.63,-58.84,;54.67,-60.38,;53.34,-61.18,;56.01,-61.12,;53.21,-53.48,;53.17,-51.93,;54.55,-54.22,;55.87,-53.42,;55.84,-51.88,;57.15,-51.09,;58.51,-51.83,;59.82,-51.04,;59.79,-49.5,;61.11,-48.71,;58.45,-48.76,;57.13,-49.55,;57.21,-54.17,;58.53,-53.38,;57.25,-55.7,)|
Show InChI InChI=1S/C130H198N40O33/c1-14-67(10)104(125(201)165-95(55-100(134)179)118(194)160-89(48-66(8)9)120(196)168-105(69(12)172)126(202)156-83(25-19-43-145-130(140)141)110(186)154-84(39-40-98(132)177)113(189)153-81(23-17-41-143-128(136)137)111(187)157-85(107(135)183)49-71-27-33-76(174)34-28-71)167-121(197)91(51-73-31-37-78(176)38-32-73)161-117(193)93(53-75-58-142-62-149-75)162-112(188)82(24-18-42-144-129(138)139)155-124(200)97-26-20-44-170(97)103(182)60-148-109(185)86(45-63(2)3)158-114(190)87(46-64(4)5)159-116(192)90(50-72-29-35-77(175)36-30-72)152-102(181)59-147-108(184)68(11)150-123(199)96(61-171)166-119(195)94(54-99(133)178)163-115(191)88(47-65(6)7)164-127(203)106(70(13)173)169-122(198)92(151-101(180)56-131)52-74-57-146-80-22-16-15-21-79(74)80/h15-16,21-22,27-38,57-58,62-70,81-97,104-106,146,171-176H,14,17-20,23-26,39-56,59-61,131H2,1-13H3,(H2,132,177)(H2,133,178)(H2,134,179)(H2,135,183)(H,142,149)(H,147,184)(H,148,185)(H,150,199)(H,151,180)(H,152,181)(H,153,189)(H,154,186)(H,155,200)(H,156,202)(H,157,187)(H,158,190)(H,159,192)(H,160,194)(H,161,193)(H,162,188)(H,163,191)(H,164,203)(H,165,201)(H,166,195)(H,167,197)(H,168,196)(H,169,198)(H4,136,137,143)(H4,138,139,144)(H4,140,141,145)/t67-,68-,69+,70+,81-,82-,83-,84-,85-,86-,87-,88-,89-,90-,91-,92-,93-,94-,95-,96-,97-,104-,105-,106-/m0/s1
Reactome pathway
KEGG

UniProtKB/SwissProt

antibodypedia
GoogleScholar
AffyNet 
CHEMBL
PC cid
PC sid
UniChem
Article
PubMed
0.300n/an/an/an/an/an/an/an/a



University of Utah

Curated by ChEMBL


Assay Description
Binding affinity to human GalR1


J Med Chem 53: 1871-5 (2010)


Article DOI: 10.1021/jm9018349
BindingDB Entry DOI: 10.7270/Q26D5TXJ
More data for this
Ligand-Target Pair
GALR1


(Homo sapiens (Human))
BDBM50293023
PNG
((Sar)WTLNSAGYLLGPKKKK | CHEMBL508036)
Show SMILES CNCC(=O)O[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(=O)NCC(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(N)=O |r|
Show InChI InChI=1S/C88H143N23O22/c1-48(2)37-62(77(121)98-45-72(117)111-36-20-27-68(111)86(130)104-61(26-15-19-35-92)80(124)103-60(25-14-18-34-91)79(123)102-59(24-13-17-33-90)78(122)101-58(75(94)119)23-12-16-32-89)105-81(125)63(38-49(3)4)106-83(127)65(40-53-28-30-55(114)31-29-53)100-71(116)44-97-76(120)51(7)99-85(129)67(47-112)109-84(128)66(42-70(93)115)107-82(126)64(39-50(5)6)108-88(132)74(52(8)113)110-87(131)69(133-73(118)46-95-9)41-54-43-96-57-22-11-10-21-56(54)57/h10-11,21-22,28-31,43,48-52,58-69,74,95-96,112-114H,12-20,23-27,32-42,44-47,89-92H2,1-9H3,(H2,93,115)(H2,94,119)(H,97,120)(H,98,121)(H,99,129)(H,100,116)(H,101,122)(H,102,123)(H,103,124)(H,104,130)(H,105,125)(H,106,127)(H,107,126)(H,108,132)(H,109,128)(H,110,131)/t51-,52+,58-,59-,60-,61-,62-,63-,64-,65-,66-,67-,68-,69-,74-/m0/s1
Reactome pathway
KEGG

UniProtKB/SwissProt

antibodypedia
GoogleScholar
AffyNet 
CHEMBL
PC cid
PC sid
UniChem
Article
PubMed
0.400n/an/an/an/an/an/an/an/a



University of Utah

Curated by ChEMBL


Assay Description
Displacement of europium labeled galanin from human recombinant GalR1 receptor by time-resolved fluorescence binding assay


J Med Chem 52: 1310-6 (2009)


Article DOI: 10.1021/jm801397w
BindingDB Entry DOI: 10.7270/Q2FF3SD5
More data for this
Ligand-Target Pair
GALR1


(Homo sapiens (Human))
BDBM50273353
PNG
((S)-1-(2-((S)-2-((S)-2-((S)-2-(2-((S)-2-((S)-2-((S...)
Show SMILES CNCC(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(=O)NCC(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(N)=O |r|
Show InChI InChI=1S/C88H144N24O21/c1-48(2)37-62(77(122)98-46-73(119)112-36-20-27-69(112)87(132)105-61(26-15-19-35-92)80(125)104-60(25-14-18-34-91)79(124)103-59(24-13-17-33-90)78(123)102-58(75(94)120)23-12-16-32-89)106-81(126)63(38-49(3)4)107-83(128)65(40-53-28-30-55(115)31-29-53)100-72(118)45-97-76(121)51(7)99-86(131)68(47-113)110-84(129)67(42-70(93)116)108-82(127)64(39-50(5)6)109-88(133)74(52(8)114)111-85(130)66(101-71(117)44-95-9)41-54-43-96-57-22-11-10-21-56(54)57/h10-11,21-22,28-31,43,48-52,58-69,74,95-96,113-115H,12-20,23-27,32-42,44-47,89-92H2,1-9H3,(H2,93,116)(H2,94,120)(H,97,121)(H,98,122)(H,99,131)(H,100,118)(H,101,117)(H,102,123)(H,103,124)(H,104,125)(H,105,132)(H,106,126)(H,107,128)(H,108,127)(H,109,133)(H,110,129)(H,111,130)/t51-,52+,58-,59-,60-,61-,62-,63-,64-,65-,66-,67-,68-,69-,74-/m0/s1
Reactome pathway
KEGG

UniProtKB/SwissProt

antibodypedia
GoogleScholar
AffyNet 
CHEMBL
PC cid
PC sid
UniChem
Article
PubMed
0.400n/an/an/an/an/an/an/an/a



University of Utah

Curated by ChEMBL


Assay Description
Displacement of europium-labeled galanin from human GalR1 expressed in HEK293 EBNA cells


J Med Chem 51: 8038-47 (2008)


Article DOI: 10.1021/jm801088x
BindingDB Entry DOI: 10.7270/Q22B8ZXD
More data for this
Ligand-Target Pair
GALR1


(Homo sapiens (Human))
BDBM50293024
PNG
((Sar)WTLNSAGYLLGPKK(Lys-MPEG4)K | CHEMBL505299)
Show SMILES CNCC(=O)O[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(=O)NCC(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCNC(=O)COCCOCCOCCOCCOC)C(=O)N[C@@H](CCCCN)C(N)=O |r|
Show InChI InChI=1S/C99H163N23O28/c1-58(2)46-72(88(133)109-54-83(129)122-37-21-28-78(122)97(142)115-71(26-15-19-35-102)91(136)113-69(25-14-18-34-101)90(135)114-70(89(134)112-68(86(104)131)24-13-17-33-100)27-16-20-36-106-82(128)57-149-45-44-148-43-42-147-41-40-146-39-38-145-10)116-92(137)73(47-59(3)4)117-94(139)75(49-63-29-31-65(125)32-30-63)111-81(127)53-108-87(132)61(7)110-96(141)77(56-123)120-95(140)76(51-80(103)126)118-93(138)74(48-60(5)6)119-99(144)85(62(8)124)121-98(143)79(150-84(130)55-105-9)50-64-52-107-67-23-12-11-22-66(64)67/h11-12,22-23,29-32,52,58-62,68-79,85,105,107,123-125H,13-21,24-28,33-51,53-57,100-102H2,1-10H3,(H2,103,126)(H2,104,131)(H,106,128)(H,108,132)(H,109,133)(H,110,141)(H,111,127)(H,112,134)(H,113,136)(H,114,135)(H,115,142)(H,116,137)(H,117,139)(H,118,138)(H,119,144)(H,120,140)(H,121,143)/t61-,62+,68-,69-,70-,71-,72-,73-,74-,75-,76-,77-,78-,79-,85-/m0/s1
Reactome pathway
KEGG

UniProtKB/SwissProt

antibodypedia
GoogleScholar
AffyNet 
CHEMBL
PC cid
PC sid
UniChem
Article
PubMed
0.5n/an/an/an/an/an/an/an/a



University of Utah

Curated by ChEMBL


Assay Description
Displacement of europium labeled galanin from human recombinant GalR1 receptor by time-resolved fluorescence binding assay


J Med Chem 52: 1310-6 (2009)


Article DOI: 10.1021/jm801397w
BindingDB Entry DOI: 10.7270/Q2FF3SD5
More data for this
Ligand-Target Pair
GALR1


(Homo sapiens (Human))
BDBM50273351
PNG
(CHEMBL508083 | GWTLNSAGYLLGPHAV-NH2)
Show SMILES CC(C)C[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)CN)[C@@H](C)O)C(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](Cc1cnc[nH]1)C(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(N)=O |r|
Show InChI InChI=1S/C77H115N21O20/c1-37(2)23-50(68(109)84-34-62(105)98-22-14-17-58(98)76(117)93-55(28-46-32-81-36-85-46)69(110)87-42(10)67(108)96-63(40(7)8)65(80)106)90-70(111)51(24-38(3)4)91-72(113)53(26-44-18-20-47(101)21-19-44)89-61(104)33-83-66(107)41(9)86-75(116)57(35-99)95-73(114)56(29-59(79)102)92-71(112)52(25-39(5)6)94-77(118)64(43(11)100)97-74(115)54(88-60(103)30-78)27-45-31-82-49-16-13-12-15-48(45)49/h12-13,15-16,18-21,31-32,36-43,50-58,63-64,82,99-101H,14,17,22-30,33-35,78H2,1-11H3,(H2,79,102)(H2,80,106)(H,81,85)(H,83,107)(H,84,109)(H,86,116)(H,87,110)(H,88,103)(H,89,104)(H,90,111)(H,91,113)(H,92,112)(H,93,117)(H,94,118)(H,95,114)(H,96,108)(H,97,115)/t41-,42-,43+,50-,51-,52-,53-,54-,55-,56-,57-,58-,63-,64-/m0/s1
Reactome pathway
KEGG

UniProtKB/SwissProt

antibodypedia
GoogleScholar
AffyNet 
CHEMBL
PC cid
PC sid
UniChem
Article
PubMed
0.5n/an/an/an/an/an/an/an/a



University of Utah

Curated by ChEMBL


Assay Description
Displacement of europium-labeled galanin from human GalR1 expressed in HEK293 EBNA cells


J Med Chem 51: 8038-47 (2008)


Article DOI: 10.1021/jm801088x
BindingDB Entry DOI: 10.7270/Q22B8ZXD
More data for this
Ligand-Target Pair
Galanin receptor 2


(Homo sapiens (Human))
BDBM50307256
PNG
(CHEMBL604373 | GWTLNSAGYLLGPrPKPQQwFwLL-CONH2 | Ga...)
Show SMILES CC(C)C[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCCN)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](CCCN=C(N)N)NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)CN)[C@@H](C)O)C(N)=O |r,wU:181.202,169.182,155.166,150.159,134.151,118.130,107.113,96.110,80.91,64.74,4.4,wD:177.186,197.209,161.174,126.138,89.94,73.77,55.65,41.56,30.40,16.28,8.12,(-10.91,-15.15,;-10.14,-13.82,;-10.9,-12.49,;-8.59,-13.83,;-7.82,-12.49,;-6.29,-12.5,;-5.52,-13.84,;-6.29,-15.17,;-3.97,-13.84,;-3.2,-12.51,;-3.97,-11.17,;-3.19,-9.85,;-5.5,-11.18,;-3.21,-15.18,;-1.67,-15.19,;-.9,-13.86,;-.9,-16.52,;-1.68,-17.86,;-1.62,-19.4,;-.32,-20.25,;-.73,-21.73,;-2.27,-21.8,;-3.25,-22.99,;-4.76,-22.74,;-5.3,-21.3,;-4.34,-20.11,;-2.81,-20.36,;.63,-16.54,;1.4,-17.87,;.62,-19.21,;2.94,-17.88,;3.72,-16.55,;2.94,-15.21,;1.41,-15.2,;.65,-13.86,;1.42,-12.54,;2.96,-12.53,;3.73,-13.87,;3.7,-19.21,;5.25,-19.16,;5.97,-17.8,;6.06,-20.47,;5.33,-21.83,;3.79,-21.88,;2.85,-20.67,;1.4,-21.19,;1.46,-22.73,;.34,-23.8,;.71,-25.29,;2.19,-25.72,;3.3,-24.65,;2.93,-23.16,;7.6,-20.42,;8.41,-21.74,;7.69,-23.08,;9.94,-21.67,;10.68,-20.31,;9.86,-19.01,;10.59,-17.64,;12.12,-17.6,;9.77,-16.33,;10.76,-22.98,;12.31,-22.93,;13.03,-21.57,;13.11,-24.23,;12.39,-25.6,;10.86,-25.65,;10.13,-27.01,;10.94,-28.32,;8.58,-27.06,;14.66,-24.17,;15.38,-22.81,;14.55,-21.5,;16.91,-22.75,;17.56,-21.34,;19.18,-21.81,;19.22,-23.48,;17.65,-24.07,;17.55,-25.6,;16.18,-26.3,;18.85,-26.45,;18.77,-27.98,;17.39,-28.68,;17.29,-30.22,;15.92,-30.91,;15.83,-32.45,;20.22,-25.75,;21.51,-26.6,;21.42,-28.13,;22.89,-25.91,;22.89,-24.35,;24.56,-24.11,;25.29,-25.62,;24.1,-26.8,;24.2,-28.34,;22.93,-29.19,;25.62,-28.92,;26.9,-28.07,;28.28,-28.74,;29.56,-27.88,;30.94,-28.56,;32.23,-27.69,;32.11,-26.16,;33.6,-28.38,;25.82,-30.45,;27.24,-31.05,;28.52,-30.19,;27.44,-32.58,;26.15,-33.45,;26.89,-34.98,;28.55,-34.74,;28.85,-33.08,;30.19,-32.31,;30.19,-30.77,;31.52,-33.08,;31.52,-34.62,;32.86,-35.39,;34.2,-34.61,;32.86,-36.92,;31.52,-37.7,;30.19,-36.92,;28.86,-37.7,;30.19,-35.39,;34.2,-37.7,;34.2,-39.24,;32.86,-40.01,;35.54,-40.01,;36.87,-39.23,;36.87,-37.69,;38.2,-36.92,;35.53,-36.92,;35.54,-41.54,;36.87,-42.31,;36.87,-43.85,;38.2,-41.54,;39.53,-42.32,;39.53,-43.84,;38.22,-44.61,;38.21,-46.16,;39.56,-46.92,;39.56,-48.46,;40.89,-46.14,;40.87,-44.61,;38.2,-39.99,;39.52,-39.23,;40.86,-40,;39.52,-37.69,;40.86,-36.91,;40.86,-35.37,;39.52,-34.61,;42.19,-34.61,;43.53,-35.37,;42.19,-33.07,;43.53,-32.29,;43.53,-30.76,;44.86,-33.06,;44.86,-34.6,;46.19,-35.37,;46.19,-32.28,;47.52,-33.05,;47.52,-34.6,;48.86,-32.28,;48.86,-30.74,;47.52,-29.97,;46.19,-30.74,;47.52,-28.44,;50.19,-33.05,;51.54,-32.29,;51.54,-30.74,;52.86,-33.05,;52.86,-34.59,;51.54,-35.37,;51.54,-36.91,;50.19,-34.59,;54.2,-32.28,;55.53,-33.05,;55.53,-34.59,;56.86,-32.28,;58.19,-33.04,;59.53,-32.27,;59.53,-30.73,;60.86,-33.04,;60.86,-34.58,;59.53,-35.35,;58.13,-34.73,;57.11,-35.88,;57.88,-37.21,;57.4,-38.68,;58.43,-39.82,;59.95,-39.49,;60.41,-38.03,;59.37,-36.89,;62.19,-32.28,;63.53,-33.05,;63.53,-34.58,;64.86,-32.28,;66.19,-33.04,;56.86,-30.74,;58.19,-29.97,;55.53,-29.97,;-8.59,-11.16,;-10.13,-11.15,;-7.81,-9.83,)|
Show InChI InChI=1S/C138H199N35O30/c1-72(2)54-95(117(144)183)160-122(188)97(56-74(5)6)163-127(193)104(63-83-68-150-90-35-21-18-32-87(83)90)166-126(192)101(59-79-28-14-13-15-29-79)164-128(194)103(62-82-67-149-89-34-20-17-31-86(82)89)165-121(187)91(45-47-110(141)177)156-120(186)92(46-48-111(142)178)157-133(199)108-39-26-52-172(108)136(202)93(36-22-23-49-139)158-134(200)109-40-27-53-173(109)137(203)94(37-24-50-147-138(145)146)159-132(198)107-38-25-51-171(107)115(182)70-152-119(185)96(55-73(3)4)161-123(189)98(57-75(7)8)162-125(191)100(60-80-41-43-84(176)44-42-80)155-114(181)69-151-118(184)77(11)153-131(197)106(71-174)169-129(195)105(64-112(143)179)167-124(190)99(58-76(9)10)168-135(201)116(78(12)175)170-130(196)102(154-113(180)65-140)61-81-66-148-88-33-19-16-30-85(81)88/h13-21,28-35,41-44,66-68,72-78,91-109,116,148-150,174-176H,22-27,36-40,45-65,69-71,139-140H2,1-12H3,(H2,141,177)(H2,142,178)(H2,143,179)(H2,144,183)(H,151,184)(H,152,185)(H,153,197)(H,154,180)(H,155,181)(H,156,186)(H,157,199)(H,158,200)(H,159,198)(H,160,188)(H,161,189)(H,162,191)(H,163,193)(H,164,194)(H,165,187)(H,166,192)(H,167,190)(H,168,201)(H,169,195)(H,170,196)(H4,145,146,147)/t77-,78+,91-,92-,93-,94+,95-,96-,97-,98-,99-,100-,101-,102-,103+,104+,105-,106-,107-,108-,109-,116-/m0/s1
Reactome pathway
KEGG

UniProtKB/SwissProt

antibodypedia
GoogleScholar
AffyNet 
CHEMBL
PC cid
PC sid
UniChem
Article
PubMed
0.600n/an/an/an/an/an/an/an/a



University of Utah

Curated by ChEMBL


Assay Description
Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assay


J Med Chem 53: 1871-5 (2010)


Article DOI: 10.1021/jm9018349
BindingDB Entry DOI: 10.7270/Q26D5TXJ
More data for this
Ligand-Target Pair
GALR1


(Homo sapiens (Human))
BDBM50293030
PNG
((Sar)WTLNSAGYLLGPKK(Lys-octanoyl)K | CHEMBL503900)
Show SMILES CCCCCCCC(=O)NCCCC[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)OC(=O)CNC)[C@@H](C)O)C(=O)N[C@@H](CCCCN)C(N)=O |r|
Show InChI InChI=1S/C96H157N23O23/c1-11-12-13-14-15-34-78(124)103-42-25-21-32-67(86(131)109-65(83(101)128)29-18-22-39-97)111-87(132)66(30-19-23-40-98)110-88(133)68(31-20-24-41-99)112-94(139)75-33-26-43-119(75)80(126)52-106-85(130)69(44-55(2)3)113-89(134)70(45-56(4)5)114-91(136)72(47-60-35-37-62(122)38-36-60)108-79(125)51-105-84(129)58(8)107-93(138)74(54-120)117-92(137)73(49-77(100)123)115-90(135)71(46-57(6)7)116-96(141)82(59(9)121)118-95(140)76(142-81(127)53-102-10)48-61-50-104-64-28-17-16-27-63(61)64/h16-17,27-28,35-38,50,55-59,65-76,82,102,104,120-122H,11-15,18-26,29-34,39-49,51-54,97-99H2,1-10H3,(H2,100,123)(H2,101,128)(H,103,124)(H,105,129)(H,106,130)(H,107,138)(H,108,125)(H,109,131)(H,110,133)(H,111,132)(H,112,139)(H,113,134)(H,114,136)(H,115,135)(H,116,141)(H,117,137)(H,118,140)/t58-,59+,65-,66-,67-,68-,69-,70-,71-,72-,73-,74-,75-,76-,82-/m0/s1
Reactome pathway
KEGG

UniProtKB/SwissProt

antibodypedia
GoogleScholar
AffyNet 
CHEMBL
KEGG
PC cid
PC sid
UniChem
Article
PubMed
0.700n/an/an/an/an/an/an/an/a



University of Utah

Curated by ChEMBL


Assay Description
Displacement of europium labeled galanin from human recombinant GalR1 receptor by time-resolved fluorescence binding assay


J Med Chem 52: 1310-6 (2009)


Article DOI: 10.1021/jm801397w
BindingDB Entry DOI: 10.7270/Q2FF3SD5
More data for this
Ligand-Target Pair
Galanin receptor 2


(Homo sapiens (Human))
BDBM50378616
PNG
(GALANIN)
Show SMILES CC[C@H](C)[C@H](NC(=O)[C@H](C)NC(=O)[C@H](Cc1cnc[nH]1)NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)CN)[C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](Cc1cnc[nH]1)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CO)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](Cc1cnc[nH]1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(N)=O |r,wU:119.123,135.139,162.167,173.179,200.207,224.233,13.20,42.48,50.61,113.119,93.96,wD:2.2,127.131,145.150,156.161,183.190,191.198,216.224,4.4,8.8,23.23,34.40,66.69,71.76,77.84,85.92,97.112,(19.04,-36.25,;18.27,-34.92,;16.73,-34.92,;15.96,-36.25,;15.96,-33.59,;14.42,-33.59,;13.65,-34.92,;14.42,-36.25,;12.11,-34.92,;11.34,-36.25,;11.34,-33.59,;9.8,-33.59,;9.03,-34.92,;9.03,-32.26,;9.8,-30.92,;9.03,-29.59,;9.66,-28.19,;8.52,-27.16,;7.18,-27.92,;7.5,-29.43,;7.49,-32.26,;6.72,-33.59,;7.49,-34.92,;5.19,-33.67,;4.35,-34.96,;2.86,-34.56,;2.78,-33.03,;4.21,-32.48,;4.62,-30.99,;6.1,-30.59,;3.53,-29.9,;2.04,-30.3,;.95,-29.21,;-.53,-29.61,;1.35,-27.72,;.26,-26.63,;-1.23,-27.03,;-2.31,-25.94,;-1.62,-28.52,;2.83,-27.32,;3.24,-25.83,;2.15,-24.75,;4.72,-25.44,;5.81,-26.53,;5.41,-28.01,;3.93,-28.41,;6.5,-29.11,;5.24,-23.51,;3.83,-22.09,;2.34,-22.49,;4.34,-20.16,;5.83,-19.76,;6.92,-20.85,;8.4,-20.45,;9.5,-21.54,;9.09,-23.02,;10.19,-24.11,;7.61,-23.42,;6.52,-22.33,;2.93,-18.75,;1.44,-19.14,;1.04,-20.63,;.03,-17.72,;-1.46,-18.12,;-1.86,-19.61,;-.77,-20.7,;-3.35,-20.01,;-3.75,-21.5,;-4.43,-18.92,;-5.93,-19.32,;-6.32,-20.81,;-7.01,-18.23,;-8.5,-18.63,;-8.9,-20.12,;-6.61,-16.74,;-7.7,-15.65,;-9.19,-16.05,;-7.3,-14.17,;-8.39,-13.08,;-9.88,-13.47,;-10.97,-12.39,;-10.28,-14.97,;-5.82,-13.77,;-5.42,-12.28,;-6.51,-11.19,;-3.93,-11.88,;-3.53,-10.4,;-4.62,-9.31,;-6.11,-9.71,;-4.22,-7.82,;-2.84,-12.97,;-1.35,-12.57,;-.95,-11.09,;-.27,-13.66,;1.22,-13.27,;2.31,-14.35,;1.91,-15.84,;3.79,-13.96,;4.12,-12.45,;5.58,-11.97,;6.06,-10.51,;7.59,-10.51,;8.07,-11.97,;9.48,-12.6,;9.64,-14.13,;8.39,-15.04,;6.99,-14.41,;6.82,-12.88,;4.89,-15.04,;4.49,-16.53,;3,-16.93,;5.58,-17.62,;7.06,-17.22,;-.66,-15.15,;.43,-16.24,;-2.15,-15.55,;16.73,-32.26,;18.27,-32.26,;15.96,-30.92,;16.73,-29.59,;15.96,-28.26,;14.42,-28.26,;13.65,-29.59,;13.65,-26.93,;18.27,-29.59,;19.04,-28.26,;19.04,-30.92,;20.57,-30.92,;21.35,-32.26,;22.88,-32.26,;23.66,-33.59,;23.66,-30.92,;21.35,-29.59,;22.88,-29.59,;20.57,-28.26,;21.35,-26.93,;20.57,-25.59,;21.35,-24.26,;20.72,-22.86,;21.87,-21.82,;23.2,-22.59,;22.88,-24.09,;22.88,-26.93,;23.66,-28.26,;23.66,-25.59,;25.19,-25.59,;25.97,-26.93,;27.5,-26.93,;28.27,-25.59,;29.81,-25.59,;30.58,-24.26,;32.12,-24.26,;29.81,-22.92,;25.97,-24.26,;27.5,-24.26,;25.19,-22.92,;25.97,-21.59,;27.5,-21.59,;28.27,-20.26,;25.19,-20.26,;25.97,-18.92,;23.66,-20.26,;22.88,-18.92,;21.35,-18.92,;20.57,-17.59,;19.04,-17.59,;18.27,-16.26,;19.04,-14.93,;20.57,-14.93,;21.35,-16.26,;23.66,-17.59,;25.19,-17.59,;22.88,-16.26,;23.66,-14.93,;22.88,-13.59,;23.66,-12.26,;23.03,-10.86,;24.18,-9.82,;25.51,-10.59,;25.19,-12.1,;25.19,-14.93,;25.97,-16.26,;25.97,-13.59,;27.5,-13.59,;28.27,-14.93,;29.81,-14.93,;30.58,-16.26,;30.58,-13.59,;28.27,-12.26,;29.81,-12.26,;27.5,-10.93,;28.27,-9.6,;29.81,-9.6,;30.58,-10.93,;32.12,-10.93,;32.89,-12.26,;34.43,-12.26,;27.5,-8.26,;28.27,-6.92,;25.97,-8.26,;25.19,-6.92,;23.66,-6.92,;22.88,-5.59,;21.35,-5.59,;20.57,-4.26,;21.35,-2.93,;20.57,-1.59,;22.88,-2.93,;23.66,-4.26,;25.97,-5.59,;27.5,-5.59,;25.19,-4.26,;25.97,-2.93,;27.5,-2.93,;28.27,-4.26,;28.27,-1.59,;29.81,-1.59,;30.58,-2.93,;32.12,-2.93,;32.89,-4.26,;32.89,-1.59,;30.58,-.26,;32.12,-.26,;29.81,1.07,;30.58,2.4,;29.81,3.74,;32.12,2.4,;32.89,3.74,;32.89,1.07,)|
Show InChI InChI=1S/C146H213N43O40/c1-15-75(10)119(187-123(207)78(13)167-129(213)101(51-84-60-154-68-162-84)182-143(227)110-31-24-42-189(110)116(200)65-161-124(208)93(43-71(2)3)173-130(214)95(45-73(6)7)174-132(216)98(49-82-34-38-88(194)39-35-82)170-114(198)63-159-122(206)77(12)166-141(225)108(66-190)186-137(221)105(55-112(150)196)179-131(215)96(46-74(8)9)183-145(229)120(79(14)192)188-140(224)100(168-113(197)58-148)50-83-59-158-90-28-20-19-27-89(83)90)144(228)184-107(57-118(203)204)139(223)180-104(54-111(149)195)136(220)178-102(52-85-61-155-69-163-85)134(218)172-92(30-23-41-157-146(152)153)127(211)185-109(67-191)142(226)176-99(47-80-25-17-16-18-26-80)133(217)177-103(53-86-62-156-70-164-86)135(219)181-106(56-117(201)202)138(222)171-91(29-21-22-40-147)126(210)175-97(48-81-32-36-87(193)37-33-81)125(209)160-64-115(199)169-94(44-72(4)5)128(212)165-76(11)121(151)205/h16-20,25-28,32-39,59-62,68-79,91-110,119-120,158,190-194H,15,21-24,29-31,40-58,63-67,147-148H2,1-14H3,(H2,149,195)(H2,150,196)(H2,151,205)(H,154,162)(H,155,163)(H,156,164)(H,159,206)(H,160,209)(H,161,208)(H,165,212)(H,166,225)(H,167,213)(H,168,197)(H,169,199)(H,170,198)(H,171,222)(H,172,218)(H,173,214)(H,174,216)(H,175,210)(H,176,226)(H,177,217)(H,178,220)(H,179,215)(H,180,223)(H,181,219)(H,182,227)(H,183,229)(H,184,228)(H,185,211)(H,186,221)(H,187,207)(H,188,224)(H,201,202)(H,203,204)(H4,152,153,157)/t75-,76-,77-,78-,79+,91-,92-,93-,94-,95-,96-,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,108-,109-,110-,119-,120-/m0/s1
Reactome pathway
KEGG

UniProtKB/SwissProt

antibodypedia
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
Article
PubMed
0.900n/an/an/an/an/an/an/an/a



University of Utah

Curated by ChEMBL


Assay Description
Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assay


J Med Chem 53: 1871-5 (2010)


Article DOI: 10.1021/jm9018349
BindingDB Entry DOI: 10.7270/Q26D5TXJ
More data for this
Ligand-Target Pair
GALR1


(Homo sapiens (Human))
BDBM50273359
PNG
((R)-1-(2-((S)-2-((S)-2-((S)-2-(2-((S)-2-((S)-2-((S...)
Show SMILES CCCCCCCCCCCCCCCC(=O)NCCCC[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@@H](CCCCN)NC(=O)[C@H]1CCCN1C(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)CNC)[C@@H](C)O)C(=O)N[C@@H](CCCCN)C(N)=O |r|
Show InChI InChI=1S/C104H174N24O22/c1-11-12-13-14-15-16-17-18-19-20-21-22-23-42-86(133)111-50-33-29-40-75(94(140)118-73(91(109)137)37-26-30-47-105)120-95(141)74(38-27-31-48-106)119-96(142)76(39-28-32-49-107)121-103(149)84-41-34-51-128(84)89(136)61-114-93(139)77(52-63(2)3)122-97(143)78(53-64(4)5)123-99(145)80(55-68-43-45-70(131)46-44-68)116-88(135)60-113-92(138)66(8)115-102(148)83(62-129)126-100(146)82(57-85(108)132)124-98(144)79(54-65(6)7)125-104(150)90(67(9)130)127-101(147)81(117-87(134)59-110-10)56-69-58-112-72-36-25-24-35-71(69)72/h24-25,35-36,43-46,58,63-67,73-84,90,110,112,129-131H,11-23,26-34,37-42,47-57,59-62,105-107H2,1-10H3,(H2,108,132)(H2,109,137)(H,111,133)(H,113,138)(H,114,139)(H,115,148)(H,116,135)(H,117,134)(H,118,140)(H,119,142)(H,120,141)(H,121,149)(H,122,143)(H,123,145)(H,124,144)(H,125,150)(H,126,146)(H,127,147)/t66-,67+,73-,74-,75+,76+,77-,78-,79-,80-,81-,82-,83-,84+,90-/m0/s1
Reactome pathway
KEGG

UniProtKB/SwissProt

antibodypedia
GoogleScholar
AffyNet 
CHEMBL
PC cid
PC sid
UniChem
Article
PubMed
0.900n/an/an/an/an/an/an/an/a



University of Utah

Curated by ChEMBL


Assay Description
Displacement of europium-labeled galanin from human GalR1 expressed in HEK293 EBNA cells


J Med Chem 51: 8038-47 (2008)


Article DOI: 10.1021/jm801088x
BindingDB Entry DOI: 10.7270/Q22B8ZXD
More data for this
Ligand-Target Pair
Galanin receptor 2


(Homo sapiens (Human))
BDBM50273369
PNG
(CHEMBL526003 | GWTLNSAGYLLGPQQFFGLM-CONH2 | Galani...)
Show SMILES CSCC[C@H](NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)CN)[C@@H](C)O)C(N)=O |r|
Show InChI InChI=1S/C104H151N25O26S/c1-54(2)39-70(91(142)113-52-87(139)129-37-20-27-80(129)103(154)120-69(33-35-82(107)134)93(144)119-68(32-34-81(106)133)94(145)124-76(44-61-23-16-13-17-24-61)99(150)123-74(43-60-21-14-12-15-22-60)92(143)112-51-86(138)116-71(40-55(3)4)95(146)118-67(89(109)140)36-38-156-11)121-96(147)72(41-56(5)6)122-98(149)75(45-62-28-30-64(132)31-29-62)117-85(137)50-111-90(141)58(9)114-102(153)79(53-130)127-100(151)78(47-83(108)135)125-97(148)73(42-57(7)8)126-104(155)88(59(10)131)128-101(152)77(115-84(136)48-105)46-63-49-110-66-26-19-18-25-65(63)66/h12-19,21-26,28-31,49,54-59,67-80,88,110,130-132H,20,27,32-48,50-53,105H2,1-11H3,(H2,106,133)(H2,107,134)(H2,108,135)(H2,109,140)(H,111,141)(H,112,143)(H,113,142)(H,114,153)(H,115,136)(H,116,138)(H,117,137)(H,118,146)(H,119,144)(H,120,154)(H,121,147)(H,122,149)(H,123,150)(H,124,145)(H,125,148)(H,126,155)(H,127,151)(H,128,152)/t58-,59+,67-,68-,69-,70-,71-,72-,73-,74-,75-,76-,77-,78-,79-,80-,88-/m0/s1
Reactome pathway
KEGG

UniProtKB/SwissProt

antibodypedia
GoogleScholar
AffyNet 
Purchase

CHEMBL
PC cid
PC sid
UniChem
Article
PubMed
1.10n/an/an/an/an/an/an/an/a



University of Utah

Curated by ChEMBL


Assay Description
Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assay


J Med Chem 53: 1871-5 (2010)


Article DOI: 10.1021/jm9018349
BindingDB Entry DOI: 10.7270/Q26D5TXJ
More data for this
Ligand-Target Pair
GALR1


(Homo sapiens (Human))
BDBM50293029
PNG
((Sar)WTLNSAGYLLGPKK(Lys-decanoyl)K | CHEMBL460706)
Show SMILES CCCCCCCCCC(=O)NCCCC[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)OC(=O)CNC)[C@@H](C)O)C(=O)N[C@@H](CCCCN)C(N)=O |r|
Show InChI InChI=1S/C98H161N23O23/c1-11-12-13-14-15-16-17-36-80(126)105-44-27-23-34-69(88(133)111-67(85(103)130)31-20-24-41-99)113-89(134)68(32-21-25-42-100)112-90(135)70(33-22-26-43-101)114-96(141)77-35-28-45-121(77)82(128)54-108-87(132)71(46-57(2)3)115-91(136)72(47-58(4)5)116-93(138)74(49-62-37-39-64(124)40-38-62)110-81(127)53-107-86(131)60(8)109-95(140)76(56-122)119-94(139)75(51-79(102)125)117-92(137)73(48-59(6)7)118-98(143)84(61(9)123)120-97(142)78(144-83(129)55-104-10)50-63-52-106-66-30-19-18-29-65(63)66/h18-19,29-30,37-40,52,57-61,67-78,84,104,106,122-124H,11-17,20-28,31-36,41-51,53-56,99-101H2,1-10H3,(H2,102,125)(H2,103,130)(H,105,126)(H,107,131)(H,108,132)(H,109,140)(H,110,127)(H,111,133)(H,112,135)(H,113,134)(H,114,141)(H,115,136)(H,116,138)(H,117,137)(H,118,143)(H,119,139)(H,120,142)/t60-,61+,67-,68-,69-,70-,71-,72-,73-,74-,75-,76-,77-,78-,84-/m0/s1
Reactome pathway
KEGG

UniProtKB/SwissProt

antibodypedia
GoogleScholar
AffyNet 
CHEMBL
PC cid
PC sid
UniChem
Article
PubMed
1.30n/an/an/an/an/an/an/an/a



University of Utah

Curated by ChEMBL


Assay Description
Displacement of europium labeled galanin from human recombinant GalR1 receptor by time-resolved fluorescence binding assay


J Med Chem 52: 1310-6 (2009)


Article DOI: 10.1021/jm801397w
BindingDB Entry DOI: 10.7270/Q2FF3SD5
More data for this
Ligand-Target Pair
GALR1


(Homo sapiens (Human))
BDBM50293028
PNG
((Sar)WTLNSAGYLLGPKK(Lys-lauroyl)K | CHEMBL507733)
Show SMILES CCCCCCCCCCCC(=O)NCCCC[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)OC(=O)CNC)[C@@H](C)O)C(=O)N[C@@H](CCCCN)C(N)=O |r|
Show InChI InChI=1S/C100H165N23O23/c1-11-12-13-14-15-16-17-18-19-38-82(128)107-46-29-25-36-71(90(135)113-69(87(105)132)33-22-26-43-101)115-91(136)70(34-23-27-44-102)114-92(137)72(35-24-28-45-103)116-98(143)79-37-30-47-123(79)84(130)56-110-89(134)73(48-59(2)3)117-93(138)74(49-60(4)5)118-95(140)76(51-64-39-41-66(126)42-40-64)112-83(129)55-109-88(133)62(8)111-97(142)78(58-124)121-96(141)77(53-81(104)127)119-94(139)75(50-61(6)7)120-100(145)86(63(9)125)122-99(144)80(146-85(131)57-106-10)52-65-54-108-68-32-21-20-31-67(65)68/h20-21,31-32,39-42,54,59-63,69-80,86,106,108,124-126H,11-19,22-30,33-38,43-53,55-58,101-103H2,1-10H3,(H2,104,127)(H2,105,132)(H,107,128)(H,109,133)(H,110,134)(H,111,142)(H,112,129)(H,113,135)(H,114,137)(H,115,136)(H,116,143)(H,117,138)(H,118,140)(H,119,139)(H,120,145)(H,121,141)(H,122,144)/t62-,63+,69-,70-,71-,72-,73-,74-,75-,76-,77-,78-,79-,80-,86-/m0/s1
Reactome pathway
KEGG

UniProtKB/SwissProt

antibodypedia
GoogleScholar
AffyNet 
CHEMBL
PC cid
PC sid
UniChem
Article
PubMed
1.40n/an/an/an/an/an/an/an/a



University of Utah

Curated by ChEMBL


Assay Description
Displacement of europium labeled galanin from human recombinant GalR1 receptor by time-resolved fluorescence binding assay


J Med Chem 52: 1310-6 (2009)


Article DOI: 10.1021/jm801397w
BindingDB Entry DOI: 10.7270/Q2FF3SD5
More data for this
Ligand-Target Pair
Galanin receptor 2


(Homo sapiens (Human))
BDBM50307255
PNG
(CHEMBL592413 | GWTLNSAGYLLGPRHYINLITRQRY-CONH2)
Show SMILES CC[C@H](C)[C@H](NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](Cc1cnc[nH]1)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)CN)[C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](Cc1ccc(O)cc1)C(N)=O |r,wU:111.115,131.138,95.103,84.88,68.80,52.59,30.39,20.28,8.17,2.2,137.142,153.158,154.161,171.176,191.196,wD:115.131,103.111,89.95,60.67,41.42,4.4,145.150,160.165,180.185,(26.61,-58.6,;26.58,-57.06,;27.89,-56.27,;29.25,-57.01,;27.87,-54.73,;26.53,-53.98,;25.2,-54.77,;25.23,-56.32,;23.86,-54.03,;23.83,-52.49,;25.14,-51.7,;26.49,-52.44,;27.81,-51.64,;27.79,-50.1,;29.1,-49.31,;26.44,-49.36,;25.12,-50.16,;22.54,-54.82,;21.14,-54.17,;19.88,-55.03,;21.03,-52.63,;22.3,-51.76,;22.17,-50.22,;23.34,-49.22,;22.74,-47.8,;21.21,-47.92,;20.86,-49.41,;19.63,-51.97,;18.21,-52.57,;18.02,-54.1,;16.99,-51.63,;17.18,-50.12,;18.6,-49.51,;18.79,-47.98,;20.2,-47.38,;20.4,-45.85,;19.17,-44.92,;21.81,-45.25,;15.57,-52.23,;14.34,-51.31,;14.54,-49.78,;12.94,-51.9,;12.81,-53.46,;11.14,-53.58,;10.5,-52.03,;11.77,-50.93,;11.77,-49.38,;10.41,-48.63,;13.1,-48.63,;13.08,-47.08,;14.42,-46.3,;15.76,-47.07,;14.41,-44.75,;15.73,-43.97,;17.08,-44.75,;18.42,-43.97,;17.1,-46.29,;13.07,-43.99,;13.06,-42.45,;14.39,-41.68,;11.72,-41.69,;10.4,-42.46,;10.4,-44.01,;9.07,-44.77,;11.75,-44.77,;11.73,-40.14,;10.37,-39.39,;9.05,-40.16,;10.38,-37.84,;11.71,-37.07,;13.04,-37.83,;13.06,-39.37,;14.39,-40.13,;15.71,-39.36,;17.06,-40.12,;15.72,-37.82,;14.38,-37.06,;9.03,-37.07,;9.02,-35.54,;10.36,-34.77,;7.68,-34.77,;7.69,-33.24,;6.36,-32.47,;5.02,-33.24,;6.34,-30.93,;7.68,-30.15,;5.01,-30.16,;5,-28.63,;6.32,-27.86,;3.66,-27.86,;2.32,-28.64,;2.35,-30.18,;3.67,-26.33,;2.31,-25.56,;.99,-26.34,;2.3,-24.01,;3.64,-23.23,;4.98,-24,;4.99,-25.56,;6.3,-23.23,;.97,-23.26,;.97,-21.72,;2.29,-20.94,;-.37,-20.95,;-1.7,-21.73,;-1.69,-23.27,;-3.03,-24.05,;-.35,-24.03,;-.37,-19.42,;-1.72,-18.65,;-3.04,-19.43,;-1.72,-17.11,;-3.07,-16.34,;-3.06,-14.81,;-1.75,-14.03,;-4.41,-14.04,;-5.73,-14.82,;-5.73,-16.36,;-4.47,-17.26,;-4.95,-18.72,;-6.5,-18.73,;-7.52,-19.88,;-9.02,-19.57,;-9.5,-18.1,;-8.48,-16.95,;-6.96,-17.27,;-4.41,-12.5,;-5.76,-11.74,;-7.08,-12.51,;-5.76,-10.2,;-7.11,-9.43,;-.4,-16.33,;-.41,-14.79,;.94,-17.09,;29.19,-53.93,;29.17,-52.39,;30.54,-54.67,;31.86,-53.88,;31.83,-52.34,;33.15,-51.55,;34.49,-52.29,;33.13,-50.01,;33.21,-54.62,;33.24,-56.17,;34.53,-53.83,;35.88,-54.58,;35.9,-56.11,;37.25,-56.86,;37.28,-58.4,;38.57,-56.06,;37.2,-53.78,;37.17,-52.24,;38.54,-54.52,;39.87,-53.73,;39.83,-52.18,;38.48,-51.44,;41.15,-51.4,;41.21,-54.47,;41.24,-56.01,;42.53,-53.68,;43.87,-54.42,;43.9,-55.97,;45.25,-56.71,;45.28,-58.25,;46.63,-58.99,;46.66,-60.53,;45.34,-61.32,;48.01,-61.28,;45.2,-53.63,;45.17,-52.08,;46.55,-54.37,;47.86,-53.57,;47.84,-52.03,;49.16,-51.24,;49.13,-49.7,;47.77,-48.95,;50.45,-48.91,;49.22,-54.32,;49.24,-55.86,;50.53,-53.52,;51.88,-54.27,;51.91,-55.81,;53.26,-56.56,;53.28,-58.09,;54.63,-58.84,;54.67,-60.38,;53.34,-61.18,;56.01,-61.12,;53.21,-53.48,;53.17,-51.93,;54.55,-54.22,;55.87,-53.42,;55.84,-51.88,;57.15,-51.09,;58.51,-51.83,;59.82,-51.04,;59.79,-49.5,;61.11,-48.71,;58.45,-48.76,;57.13,-49.55,;57.21,-54.17,;58.53,-53.38,;57.25,-55.7,)|
Show InChI InChI=1S/C130H198N40O33/c1-14-67(10)104(125(201)165-95(55-100(134)179)118(194)160-89(48-66(8)9)120(196)168-105(69(12)172)126(202)156-83(25-19-43-145-130(140)141)110(186)154-84(39-40-98(132)177)113(189)153-81(23-17-41-143-128(136)137)111(187)157-85(107(135)183)49-71-27-33-76(174)34-28-71)167-121(197)91(51-73-31-37-78(176)38-32-73)161-117(193)93(53-75-58-142-62-149-75)162-112(188)82(24-18-42-144-129(138)139)155-124(200)97-26-20-44-170(97)103(182)60-148-109(185)86(45-63(2)3)158-114(190)87(46-64(4)5)159-116(192)90(50-72-29-35-77(175)36-30-72)152-102(181)59-147-108(184)68(11)150-123(199)96(61-171)166-119(195)94(54-99(133)178)163-115(191)88(47-65(6)7)164-127(203)106(70(13)173)169-122(198)92(151-101(180)56-131)52-74-57-146-80-22-16-15-21-79(74)80/h15-16,21-22,27-38,57-58,62-70,81-97,104-106,146,171-176H,14,17-20,23-26,39-56,59-61,131H2,1-13H3,(H2,132,177)(H2,133,178)(H2,134,179)(H2,135,183)(H,142,149)(H,147,184)(H,148,185)(H,150,199)(H,151,180)(H,152,181)(H,153,189)(H,154,186)(H,155,200)(H,156,202)(H,157,187)(H,158,190)(H,159,192)(H,160,194)(H,161,193)(H,162,188)(H,163,191)(H,164,203)(H,165,201)(H,166,195)(H,167,197)(H,168,196)(H,169,198)(H4,136,137,143)(H4,138,139,144)(H4,140,141,145)/t67-,68-,69+,70+,81-,82-,83-,84-,85-,86-,87-,88-,89-,90-,91-,92-,93-,94-,95-,96-,97-,104-,105-,106-/m0/s1
Reactome pathway
KEGG

UniProtKB/SwissProt

antibodypedia
GoogleScholar
AffyNet 
CHEMBL
PC cid
PC sid
UniChem
Article
PubMed
1.40n/an/an/an/an/an/an/an/a



University of Utah

Curated by ChEMBL


Assay Description
Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assay


J Med Chem 53: 1871-5 (2010)


Article DOI: 10.1021/jm9018349
BindingDB Entry DOI: 10.7270/Q26D5TXJ
More data for this
Ligand-Target Pair
Galanin receptor 2


(Homo sapiens (Human))
BDBM50307254
PNG
(CHEMBL604990 | GWTLNSAGYLLGPPPALALA-CONH2 | M40)
Show SMILES CC(C)C[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)CN)[C@@H](C)O)C(=O)NCC(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(N)=O |r|
Show InChI InChI=1S/C94H145N23O24/c1-46(2)33-61(82(129)100-44-76(124)115-30-19-24-71(115)93(140)117-32-20-25-72(117)94(141)116-31-18-23-70(116)91(138)104-54(14)81(128)108-63(35-48(5)6)84(131)103-53(13)80(127)107-62(34-47(3)4)83(130)101-51(11)78(97)125)109-85(132)64(36-49(7)8)110-87(134)66(38-56-26-28-58(120)29-27-56)106-75(123)43-99-79(126)52(12)102-90(137)69(45-118)113-88(135)68(40-73(96)121)111-86(133)65(37-50(9)10)112-92(139)77(55(15)119)114-89(136)67(105-74(122)41-95)39-57-42-98-60-22-17-16-21-59(57)60/h16-17,21-22,26-29,42,46-55,61-72,77,98,118-120H,18-20,23-25,30-41,43-45,95H2,1-15H3,(H2,96,121)(H2,97,125)(H,99,126)(H,100,129)(H,101,130)(H,102,137)(H,103,131)(H,104,138)(H,105,122)(H,106,123)(H,107,127)(H,108,128)(H,109,132)(H,110,134)(H,111,133)(H,112,139)(H,113,135)(H,114,136)/t51-,52-,53-,54-,55+,61-,62-,63-,64-,65-,66-,67-,68-,69-,70-,71-,72-,77-/m0/s1
Reactome pathway
KEGG

UniProtKB/SwissProt

antibodypedia
GoogleScholar
AffyNet 
CHEMBL
PC cid
PC sid
UniChem
Article
PubMed
1.5n/an/an/an/an/an/an/an/a



University of Utah

Curated by ChEMBL


Assay Description
Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assay


J Med Chem 53: 1871-5 (2010)


Article DOI: 10.1021/jm9018349
BindingDB Entry DOI: 10.7270/Q26D5TXJ
More data for this
Ligand-Target Pair
GALR1


(Homo sapiens (Human))
BDBM50307258
PNG
(CHEMBL578317 | [N-Ac,des-Sar]Gal-B2)
Show SMILES CCCCCCCCCCCCCCCC(=O)NCCCC[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(C)=O)[C@@H](C)O)C(=O)N[C@@H](CCCCN)C(N)=O |r|
Show InChI InChI=1S/C103H171N23O22/c1-11-12-13-14-15-16-17-18-19-20-21-22-23-42-86(132)109-50-33-29-40-75(93(138)116-73(90(108)135)37-26-30-47-104)118-94(139)74(38-27-31-48-105)117-95(140)76(39-28-32-49-106)119-102(147)84-41-34-51-126(84)88(134)60-112-92(137)77(52-62(2)3)120-96(141)78(53-63(4)5)121-98(143)80(55-68-43-45-70(130)46-44-68)115-87(133)59-111-91(136)65(8)113-101(146)83(61-127)124-99(144)82(57-85(107)131)122-97(142)79(54-64(6)7)123-103(148)89(66(9)128)125-100(145)81(114-67(10)129)56-69-58-110-72-36-25-24-35-71(69)72/h24-25,35-36,43-46,58,62-66,73-84,89,110,127-128,130H,11-23,26-34,37-42,47-57,59-61,104-106H2,1-10H3,(H2,107,131)(H2,108,135)(H,109,132)(H,111,136)(H,112,137)(H,113,146)(H,114,129)(H,115,133)(H,116,138)(H,117,140)(H,118,139)(H,119,147)(H,120,141)(H,121,143)(H,122,142)(H,123,148)(H,124,144)(H,125,145)/t65-,66+,73-,74-,75-,76-,77-,78-,79-,80-,81-,82-,83-,84-,89-/m0/s1
Reactome pathway
KEGG

UniProtKB/SwissProt

antibodypedia
GoogleScholar
AffyNet 
CHEMBL
PC cid
PC sid
UniChem
Article
PubMed
1.70n/an/an/an/an/an/an/an/a



University of Utah

Curated by ChEMBL


Assay Description
Displacement of Eu-labeled galanin from human GalR1 by DELFIA competitive assay


J Med Chem 53: 1871-5 (2010)


Article DOI: 10.1021/jm9018349
BindingDB Entry DOI: 10.7270/Q26D5TXJ
More data for this
Ligand-Target Pair
Galanin receptor 2


(Homo sapiens (Human))
BDBM50307252
PNG
(CHEMBL578710 | WTLNSAGYLL-CONH2)
Show SMILES CC(C)C[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@@H](N)Cc1c[nH]c2ccccc12)[C@@H](C)O)C(N)=O |r|
Show InChI InChI=1S/C54H81N13O14/c1-26(2)17-37(46(57)73)62-49(76)38(18-27(3)4)63-51(78)40(20-31-13-15-33(70)16-14-31)61-44(72)24-59-47(74)29(7)60-53(80)42(25-68)66-52(79)41(22-43(56)71)64-50(77)39(19-28(5)6)65-54(81)45(30(8)69)67-48(75)35(55)21-32-23-58-36-12-10-9-11-34(32)36/h9-16,23,26-30,35,37-42,45,58,68-70H,17-22,24-25,55H2,1-8H3,(H2,56,71)(H2,57,73)(H,59,74)(H,60,80)(H,61,72)(H,62,76)(H,63,78)(H,64,77)(H,65,81)(H,66,79)(H,67,75)/t29-,30+,35-,37-,38-,39-,40-,41-,42-,45-/m0/s1
Reactome pathway
KEGG

UniProtKB/SwissProt

antibodypedia
GoogleScholar
AffyNet 
Purchase

CHEMBL
PC cid
PC sid
UniChem
Article
PubMed
1.70n/an/an/an/an/an/an/an/a



University of Utah

Curated by ChEMBL


Assay Description
Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assay


J Med Chem 53: 1871-5 (2010)


Article DOI: 10.1021/jm9018349
BindingDB Entry DOI: 10.7270/Q26D5TXJ
More data for this
Ligand-Target Pair
Galanin receptor 2


(Homo sapiens (Human))
BDBM50273370
PNG
((2S)-2-[(2S)-2-[(2S,3R)-2-[(2S)-2-(2-aminoacetamid...)
Show SMILES CC(C)C[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)CN)[C@@H](C)O)C(=O)NCC(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CO)C(=O)N1CCC[C@H]1C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CCCN=C(N)N)C(N)=O |r,wU:106.112,4.4,8.12,32.33,37.40,43.48,51.56,63.76,wD:149.157,138.145,134.142,125.131,114.119,99.104,92.96,16.25,59.60,79.83,(16.53,-9.13,;15.19,-9.9,;15.2,-11.44,;13.86,-9.13,;12.52,-9.9,;11.19,-9.13,;11.19,-7.59,;12.53,-6.82,;9.86,-6.82,;9.86,-5.28,;11.2,-4.51,;12.52,-5.28,;11.2,-2.97,;8.13,-7.82,;6.39,-6.82,;6.39,-5.28,;4.66,-7.83,;4.66,-9.36,;5.99,-10.13,;5.99,-11.67,;7.32,-12.44,;8.66,-11.67,;9.99,-12.44,;8.66,-10.13,;7.33,-9.36,;2.92,-6.82,;2.92,-5.28,;4.26,-4.52,;1.19,-4.28,;1.19,-2.75,;2.52,-1.97,;3.86,-2.74,;2.52,-.43,;3.86,.34,;1.2,.34,;1.19,1.88,;2.53,2.65,;-.14,2.65,;-.14,4.19,;1.19,4.96,;-1.48,1.88,;-2.81,2.65,;-2.81,4.19,;-4.14,1.88,;-5.48,2.64,;-5.47,4.19,;-6.81,4.96,;-4.14,4.96,;-4.15,.34,;-5.48,-.43,;-6.81,.34,;-5.48,-1.97,;-6.81,-2.74,;-8.14,-1.97,;-8.14,-.43,;-9.47,-2.74,;-4.14,-2.74,;-4.14,-4.28,;-5.48,-5.05,;-2.81,-5.05,;-2.81,-6.59,;-1.48,-7.36,;-.15,-6.59,;-1.48,-8.9,;-2.85,-9.59,;-4.14,-8.76,;-4.22,-7.22,;-5.71,-6.82,;-6.55,-8.12,;-8.07,-8.35,;-8.62,-9.79,;-7.65,-10.99,;-6.13,-10.75,;-5.58,-9.31,;-.14,-9.67,;1.19,-8.9,;1.19,-7.36,;2.53,-9.67,;2.53,-11.21,;-1.47,-4.28,;-.15,-5.05,;-1.47,-2.74,;12.53,-11.44,;13.86,-12.21,;11.19,-12.21,;11.19,-13.75,;12.53,-14.52,;13.86,-13.75,;12.53,-16.06,;11.28,-16.96,;11.76,-18.43,;13.29,-18.43,;13.77,-16.97,;15.24,-16.49,;15.64,-15,;16.65,-17.91,;16.41,-19.42,;17.78,-20.13,;18.87,-19.04,;18.18,-17.67,;19.08,-15.88,;20.62,-15.8,;18.31,-14.55,;16.78,-14.38,;16.46,-12.88,;17.8,-12.12,;18.94,-13.14,;20.31,-12.44,;21.65,-13.21,;20.31,-10.9,;21.64,-10.13,;22.97,-10.89,;24.3,-10.12,;22.98,-12.43,;24.31,-13.2,;24.32,-14.74,;25.65,-15.5,;25.66,-17.04,;26.99,-17.81,;28.33,-17.04,;28.32,-15.5,;26.99,-14.73,;25.64,-12.43,;25.64,-10.89,;26.98,-13.19,;28.31,-12.42,;29.65,-13.18,;30.98,-12.41,;28.31,-10.88,;26.97,-10.11,;29.64,-10.1,;31.05,-10.72,;32.07,-9.57,;31.3,-8.24,;29.8,-8.57,;28.51,-7.72,;27.17,-8.47,;28.53,-6.17,;29.88,-5.42,;31.2,-6.21,;32.54,-5.45,;32.56,-3.91,;33.91,-3.16,;35.23,-3.95,;35.21,-5.49,;33.87,-6.24,;29.9,-3.88,;31.24,-3.12,;28.57,-3.1,;28.59,-1.55,;29.93,-.8,;29.95,.74,;28.63,1.53,;28.65,3.07,;29.99,3.82,;30.01,5.36,;31.32,3.03,;27.27,-.77,;27.29,.77,;25.92,-1.52,)|
Show InChI InChI=1S/C107H153N27O26/c1-57(2)42-70(123-93(147)71(43-58(3)4)124-95(149)74(47-64-33-35-66(138)36-34-64)121-86(141)52-115-91(145)60(7)118-100(154)78(55-135)128-98(152)77(49-84(109)139)125-94(148)72(44-59(5)6)127-103(157)89(61(8)137)130-99(153)76(119-85(140)50-108)48-65-51-114-68-27-16-15-26-67(65)68)92(146)117-54-88(143)131-38-20-31-82(131)105(159)134-41-21-32-83(134)106(160)133-40-18-29-80(133)101(155)116-53-87(142)120-73(45-62-22-11-9-12-23-62)96(150)129-79(56-136)104(158)132-39-19-30-81(132)102(156)126-75(46-63-24-13-10-14-25-63)97(151)122-69(90(110)144)28-17-37-113-107(111)112/h9-16,22-27,33-36,51,57-61,69-83,89,114,135-138H,17-21,28-32,37-50,52-56,108H2,1-8H3,(H2,109,139)(H2,110,144)(H,115,145)(H,116,155)(H,117,146)(H,118,154)(H,119,140)(H,120,142)(H,121,141)(H,122,151)(H,123,147)(H,124,149)(H,125,148)(H,126,156)(H,127,157)(H,128,152)(H,129,150)(H,130,153)(H4,111,112,113)/t60-,61+,69-,70-,71-,72-,73-,74-,75-,76-,77-,78-,79-,80-,81-,82-,83-,89-/m0/s1
Reactome pathway
KEGG

UniProtKB/SwissProt

antibodypedia
GoogleScholar
AffyNet 
CHEMBL
PC cid
PC sid
UniChem
Article
PubMed
1.80n/an/an/an/an/an/an/an/a



University of Utah

Curated by ChEMBL


Assay Description
Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assay


J Med Chem 53: 1871-5 (2010)


Article DOI: 10.1021/jm9018349
BindingDB Entry DOI: 10.7270/Q26D5TXJ
More data for this
Ligand-Target Pair
GALR1


(Homo sapiens (Human))
BDBM50273354
PNG
((S)-1-(2-((S)-2-((S)-2-((S)-2-(2-((S)-2-((S)-2-((S...)
Show SMILES CCCCCCCCCCCCCCCC(=O)NCCCC[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)CNC)[C@@H](C)O)C(N)=O |r|
Show InChI InChI=1S/C104H174N24O22/c1-11-12-13-14-15-16-17-18-19-20-21-22-23-42-86(133)111-50-33-29-37-73(91(109)137)118-94(140)74(38-26-30-47-105)119-95(141)75(39-27-31-48-106)120-96(142)76(40-28-32-49-107)121-103(149)84-41-34-51-128(84)89(136)61-114-93(139)77(52-63(2)3)122-97(143)78(53-64(4)5)123-99(145)80(55-68-43-45-70(131)46-44-68)116-88(135)60-113-92(138)66(8)115-102(148)83(62-129)126-100(146)82(57-85(108)132)124-98(144)79(54-65(6)7)125-104(150)90(67(9)130)127-101(147)81(117-87(134)59-110-10)56-69-58-112-72-36-25-24-35-71(69)72/h24-25,35-36,43-46,58,63-67,73-84,90,110,112,129-131H,11-23,26-34,37-42,47-57,59-62,105-107H2,1-10H3,(H2,108,132)(H2,109,137)(H,111,133)(H,113,138)(H,114,139)(H,115,148)(H,116,135)(H,117,134)(H,118,140)(H,119,141)(H,120,142)(H,121,149)(H,122,143)(H,123,145)(H,124,144)(H,125,150)(H,126,146)(H,127,147)/t66-,67+,73-,74-,75-,76-,77-,78-,79-,80-,81-,82-,83-,84-,90-/m0/s1
Reactome pathway
KEGG

UniProtKB/SwissProt

antibodypedia
GoogleScholar
AffyNet 
CHEMBL
PC cid
PC sid
UniChem
Article
PubMed
1.90n/an/an/an/an/an/an/an/a



University of Utah

Curated by ChEMBL


Assay Description
Displacement of europium-labeled galanin from human GalR1 expressed in HEK293 EBNA cells


J Med Chem 51: 8038-47 (2008)


Article DOI: 10.1021/jm801088x
BindingDB Entry DOI: 10.7270/Q22B8ZXD
More data for this
Ligand-Target Pair
GALR1


(Homo sapiens (Human))
BDBM50293027
PNG
((Sar)WTLNSAGYLLGPKK(Lys-myristoyl)K | CHEMBL524678)
Show SMILES CCCCCCCCCCCCCC(=O)NCCCC[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)OC(=O)CNC)[C@@H](C)O)C(=O)N[C@@H](CCCCN)C(N)=O |r|
Show InChI InChI=1S/C102H169N23O23/c1-11-12-13-14-15-16-17-18-19-20-21-40-84(130)109-48-31-27-38-73(92(137)115-71(89(107)134)35-24-28-45-103)117-93(138)72(36-25-29-46-104)116-94(139)74(37-26-30-47-105)118-100(145)81-39-32-49-125(81)86(132)58-112-91(136)75(50-61(2)3)119-95(140)76(51-62(4)5)120-97(142)78(53-66-41-43-68(128)44-42-66)114-85(131)57-111-90(135)64(8)113-99(144)80(60-126)123-98(143)79(55-83(106)129)121-96(141)77(52-63(6)7)122-102(147)88(65(9)127)124-101(146)82(148-87(133)59-108-10)54-67-56-110-70-34-23-22-33-69(67)70/h22-23,33-34,41-44,56,61-65,71-82,88,108,110,126-128H,11-21,24-32,35-40,45-55,57-60,103-105H2,1-10H3,(H2,106,129)(H2,107,134)(H,109,130)(H,111,135)(H,112,136)(H,113,144)(H,114,131)(H,115,137)(H,116,139)(H,117,138)(H,118,145)(H,119,140)(H,120,142)(H,121,141)(H,122,147)(H,123,143)(H,124,146)/t64-,65+,71-,72-,73-,74-,75-,76-,77-,78-,79-,80-,81-,82-,88-/m0/s1
Reactome pathway
KEGG

UniProtKB/SwissProt

antibodypedia
GoogleScholar
AffyNet 
CHEMBL
PC cid
PC sid
UniChem
Article
PubMed
2.60n/an/an/an/an/an/an/an/a



University of Utah

Curated by ChEMBL


Assay Description
Displacement of europium labeled galanin from human recombinant GalR1 receptor by time-resolved fluorescence binding assay


J Med Chem 52: 1310-6 (2009)


Article DOI: 10.1021/jm801397w
BindingDB Entry DOI: 10.7270/Q2FF3SD5
More data for this
Ligand-Target Pair
GALR1


(Homo sapiens (Human))
BDBM50273360
PNG
((S)-N-((S)-6-amino-1-((S)-6-amino-1-((S)-1-((S)-1,...)
Show SMILES CCCCCCCCCCCCCCCC(=O)NCCCC[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)CN)[C@@H](C)O)C(=O)N[C@@H](CCCCN)C(N)=O |r|
Show InChI InChI=1S/C103H172N24O22/c1-10-11-12-13-14-15-16-17-18-19-20-21-22-41-85(132)110-49-32-28-39-74(93(139)117-72(90(109)136)36-25-29-46-104)119-94(140)73(37-26-30-47-105)118-95(141)75(38-27-31-48-106)120-102(148)83-40-33-50-127(83)88(135)60-113-92(138)76(51-62(2)3)121-96(142)77(52-63(4)5)122-98(144)79(54-67-42-44-69(130)45-43-67)116-87(134)59-112-91(137)65(8)114-101(147)82(61-128)125-99(145)81(56-84(108)131)123-97(143)78(53-64(6)7)124-103(149)89(66(9)129)126-100(146)80(115-86(133)57-107)55-68-58-111-71-35-24-23-34-70(68)71/h23-24,34-35,42-45,58,62-66,72-83,89,111,128-130H,10-22,25-33,36-41,46-57,59-61,104-107H2,1-9H3,(H2,108,131)(H2,109,136)(H,110,132)(H,112,137)(H,113,138)(H,114,147)(H,115,133)(H,116,134)(H,117,139)(H,118,141)(H,119,140)(H,120,148)(H,121,142)(H,122,144)(H,123,143)(H,124,149)(H,125,145)(H,126,146)/t65-,66+,72-,73-,74-,75-,76-,77-,78-,79-,80-,81-,82-,83-,89-/m0/s1
Reactome pathway
KEGG

UniProtKB/SwissProt

antibodypedia
GoogleScholar
AffyNet 
CHEMBL
PC cid
PC sid
UniChem
Article
PubMed
2.80n/an/an/an/an/an/an/an/a



University of Utah

Curated by ChEMBL


Assay Description
Displacement of Eu-labeled galanin from human GalR1 by DELFIA competitive assay


J Med Chem 53: 1871-5 (2010)


Article DOI: 10.1021/jm9018349
BindingDB Entry DOI: 10.7270/Q26D5TXJ
More data for this
Ligand-Target Pair
GALR1


(Homo sapiens (Human))
BDBM50273362
PNG
((S)-1-(2-((S)-2-((S)-2-((S)-2-(2-((S)-2-((S)-2-((S...)
Show SMILES CCCCCCCCCCCCCCCC(=O)NCCCC[C@H](NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)CNC)[C@@H](C)O)C(=O)N[C@@H](CCCN=C(N)N)C(N)=O |r,wU:48.47,26.33,145.148,67.72,110.116,122.136,96.100,wD:91.93,37.44,22.22,118.120,75.85,139.144,59.64,102.108,(48.91,-37.06,;47.43,-36.66,;47.03,-35.18,;45.54,-34.78,;45.14,-33.29,;43.65,-32.89,;43.25,-31.4,;41.77,-31.01,;41.37,-29.52,;39.88,-29.12,;39.48,-27.63,;38,-27.23,;37.6,-25.75,;36.11,-25.35,;35.71,-23.86,;34.22,-23.46,;33.13,-24.55,;33.82,-21.97,;35.04,-21.03,;34.83,-19.51,;36.05,-18.57,;35.84,-17.04,;37.06,-16.1,;36.76,-14.58,;35.3,-14.1,;34.14,-15.11,;35,-12.58,;36.16,-11.57,;37.62,-12.06,;38.78,-11.05,;38.48,-9.54,;39.7,-8.59,;41.12,-9.16,;39.48,-7.06,;33.55,-12.09,;33.25,-10.59,;34.4,-9.56,;31.79,-10.08,;30.63,-11.1,;30.93,-12.61,;29.77,-13.63,;30.07,-15.14,;28.92,-16.17,;27.46,-15.66,;29.22,-17.67,;31.49,-8.57,;30.03,-8.08,;28.87,-9.09,;29.71,-6.54,;30.8,-5.45,;30.02,-4.09,;28.52,-4.38,;28.33,-5.92,;27.1,-6.6,;25.77,-5.84,;27.11,-8.14,;25.76,-8.9,;25.78,-10.44,;27.12,-11.21,;24.45,-11.21,;24.45,-12.75,;25.78,-13.52,;25.78,-15.07,;27.12,-12.75,;23.11,-10.43,;21.78,-11.22,;21.79,-12.76,;20.45,-10.45,;20.45,-8.92,;21.79,-8.15,;21.78,-6.6,;23.11,-8.92,;19.1,-11.21,;17.76,-10.44,;17.76,-8.9,;16.43,-11.21,;16.43,-12.76,;17.77,-13.52,;19.1,-12.75,;20.43,-13.52,;20.44,-15.06,;21.77,-15.82,;19.1,-15.83,;17.77,-15.06,;15.1,-10.44,;13.77,-11.22,;13.77,-12.76,;12.44,-10.45,;11.09,-11.2,;9.75,-10.44,;9.75,-8.9,;8.42,-11.21,;8.41,-12.75,;7.08,-10.43,;5.75,-11.21,;5.76,-12.75,;4.42,-10.45,;4.42,-8.9,;5.75,-8.12,;3.09,-11.22,;1.76,-10.45,;1.76,-8.91,;.42,-11.22,;.43,-12.76,;1.76,-13.52,;3.09,-12.75,;1.76,-15.06,;-.92,-10.45,;-2.24,-11.22,;-2.24,-12.75,;-3.58,-10.45,;-3.58,-8.91,;-2.24,-8.14,;-2.24,-6.6,;-.91,-8.91,;-4.92,-11.21,;-6.26,-10.46,;-6.25,-8.91,;-7.59,-11.22,;-8.93,-10.45,;-10.25,-11.22,;-10.25,-12.76,;-11.61,-10.45,;-11.61,-8.92,;-10.26,-8.15,;-8.86,-8.77,;-7.83,-7.62,;-8.6,-6.29,;-8.13,-4.82,;-9.15,-3.68,;-10.66,-4,;-11.15,-5.46,;-10.12,-6.6,;-12.94,-11.22,;-14.29,-10.45,;-14.28,-8.91,;-15.62,-11.22,;-16.94,-10.44,;-18.28,-11.21,;-7.59,-12.76,;-8.92,-13.53,;-6.25,-13.53,;38.48,-16.68,;39.7,-15.74,;38.69,-18.2,;40.12,-18.79,;41.34,-17.85,;42.77,-18.43,;43.98,-17.49,;45.41,-18.06,;46.64,-17.13,;46.41,-15.57,;48.06,-17.69,;40.33,-20.32,;41.76,-20.89,;39.1,-21.26,)|
Show InChI InChI=1S/C104H174N30O22/c1-11-12-13-14-15-16-17-18-19-20-21-22-23-39-83(139)114-44-27-26-34-71(91(146)124-70(88(106)143)35-28-45-115-102(107)108)125-92(147)72(36-29-46-116-103(109)110)126-93(148)73(37-30-47-117-104(111)112)127-100(155)81-38-31-48-134(81)86(142)58-120-90(145)74(49-60(2)3)128-94(149)75(50-61(4)5)129-96(151)77(52-65-40-42-67(137)43-41-65)122-85(141)57-119-89(144)63(8)121-99(154)80(59-135)132-97(152)79(54-82(105)138)130-95(150)76(51-62(6)7)131-101(156)87(64(9)136)133-98(153)78(123-84(140)56-113-10)53-66-55-118-69-33-25-24-32-68(66)69/h24-25,32-33,40-43,55,60-64,70-81,87,113,118,135-137H,11-23,26-31,34-39,44-54,56-59H2,1-10H3,(H2,105,138)(H2,106,143)(H,114,139)(H,119,144)(H,120,145)(H,121,154)(H,122,141)(H,123,140)(H,124,146)(H,125,147)(H,126,148)(H,127,155)(H,128,149)(H,129,151)(H,130,150)(H,131,156)(H,132,152)(H,133,153)(H4,107,108,115)(H4,109,110,116)(H4,111,112,117)/t63-,64+,70-,71-,72-,73-,74-,75-,76-,77-,78-,79-,80-,81-,87-/m0/s1
Reactome pathway
KEGG

UniProtKB/SwissProt

antibodypedia
GoogleScholar
AffyNet 
CHEMBL
PC cid
PC sid
UniChem
Article
PubMed
3.30n/an/an/an/an/an/an/an/a



University of Utah

Curated by ChEMBL


Assay Description
Displacement of europium-labeled galanin from human GalR1 expressed in HEK293 EBNA cells


J Med Chem 51: 8038-47 (2008)


Article DOI: 10.1021/jm801088x
BindingDB Entry DOI: 10.7270/Q22B8ZXD
More data for this
Ligand-Target Pair
GALR1


(Homo sapiens (Human))
BDBM50307250
PNG
(CHEMBL578514 | GalB2)
Show SMILES CCCCCCCCCCCCCCCC(=O)NCCCC[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)CNC)[C@@H](C)O)C(=O)N[C@@H](CCCCN)C(O)=O |r|
Show InChI InChI=1S/C104H173N23O23/c1-11-12-13-14-15-16-17-18-19-20-21-22-23-42-86(132)110-50-33-29-39-74(95(140)120-76(104(149)150)40-28-32-49-107)118-93(138)73(37-26-30-47-105)117-94(139)75(38-27-31-48-106)119-102(147)84-41-34-51-127(84)89(135)61-113-92(137)77(52-63(2)3)121-96(141)78(53-64(4)5)122-98(143)80(55-68-43-45-70(130)46-44-68)115-88(134)60-112-91(136)66(8)114-101(146)83(62-128)125-99(144)82(57-85(108)131)123-97(142)79(54-65(6)7)124-103(148)90(67(9)129)126-100(145)81(116-87(133)59-109-10)56-69-58-111-72-36-25-24-35-71(69)72/h24-25,35-36,43-46,58,63-67,73-84,90,109,111,128-130H,11-23,26-34,37-42,47-57,59-62,105-107H2,1-10H3,(H2,108,131)(H,110,132)(H,112,136)(H,113,137)(H,114,146)(H,115,134)(H,116,133)(H,117,139)(H,118,138)(H,119,147)(H,120,140)(H,121,141)(H,122,143)(H,123,142)(H,124,148)(H,125,144)(H,126,145)(H,149,150)/t66-,67+,73-,74-,75-,76-,77-,78-,79-,80-,81-,82-,83-,84-,90-/m0/s1
Reactome pathway
KEGG

UniProtKB/SwissProt

antibodypedia
GoogleScholar
AffyNet 
CHEMBL
PC cid
PC sid
UniChem
Article
PubMed
3.5n/an/an/an/an/an/an/an/a



University of Utah

Curated by ChEMBL


Assay Description
Binding affinity to human GalR1


J Med Chem 53: 1871-5 (2010)


Article DOI: 10.1021/jm9018349
BindingDB Entry DOI: 10.7270/Q26D5TXJ
More data for this
Ligand-Target Pair
GALR1


(Homo sapiens (Human))
BDBM50293026
PNG
((Sar)WTLNSAGYLLGPKK(Lys-palmitoyl)K | CHEMBL507353)
Show SMILES CCCCCCCCCCCCCCCC(=O)NCCCC[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)OC(=O)CNC)[C@@H](C)O)C(=O)N[C@@H](CCCCN)C(N)=O |r|
Show InChI InChI=1S/C104H173N23O23/c1-11-12-13-14-15-16-17-18-19-20-21-22-23-42-86(132)111-50-33-29-40-75(94(139)117-73(91(109)136)37-26-30-47-105)119-95(140)74(38-27-31-48-106)118-96(141)76(39-28-32-49-107)120-102(147)83-41-34-51-127(83)88(134)60-114-93(138)77(52-63(2)3)121-97(142)78(53-64(4)5)122-99(144)80(55-68-43-45-70(130)46-44-68)116-87(133)59-113-92(137)66(8)115-101(146)82(62-128)125-100(145)81(57-85(108)131)123-98(143)79(54-65(6)7)124-104(149)90(67(9)129)126-103(148)84(150-89(135)61-110-10)56-69-58-112-72-36-25-24-35-71(69)72/h24-25,35-36,43-46,58,63-67,73-84,90,110,112,128-130H,11-23,26-34,37-42,47-57,59-62,105-107H2,1-10H3,(H2,108,131)(H2,109,136)(H,111,132)(H,113,137)(H,114,138)(H,115,146)(H,116,133)(H,117,139)(H,118,141)(H,119,140)(H,120,147)(H,121,142)(H,122,144)(H,123,143)(H,124,149)(H,125,145)(H,126,148)/t66-,67+,73-,74-,75-,76-,77-,78-,79-,80-,81-,82-,83-,84-,90-/m0/s1
Reactome pathway
KEGG

UniProtKB/SwissProt

antibodypedia
GoogleScholar
AffyNet 
CHEMBL
PC cid
PC sid
UniChem
Article
PubMed
3.5n/an/an/an/an/an/an/an/a



University of Utah

Curated by ChEMBL


Assay Description
Displacement of europium labeled galanin from human recombinant GalR1 receptor by time-resolved fluorescence binding assay


J Med Chem 52: 1310-6 (2009)


Article DOI: 10.1021/jm801397w
BindingDB Entry DOI: 10.7270/Q2FF3SD5
More data for this
Ligand-Target Pair
GALR1


(Homo sapiens (Human))
BDBM50273355
PNG
((S)-1-(2-((S)-2-((S)-2-((S)-2-(2-((S)-2-((S)-2-((S...)
Show SMILES CCCCCCCCCCCCCCCC(=O)NCCCC[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)CNC)[C@@H](C)O)C(=O)N[C@@H](CCCCN)C(N)=O |r|
Show InChI InChI=1S/C104H174N24O22/c1-11-12-13-14-15-16-17-18-19-20-21-22-23-42-86(133)111-50-33-29-40-75(94(140)118-73(91(109)137)37-26-30-47-105)120-95(141)74(38-27-31-48-106)119-96(142)76(39-28-32-49-107)121-103(149)84-41-34-51-128(84)89(136)61-114-93(139)77(52-63(2)3)122-97(143)78(53-64(4)5)123-99(145)80(55-68-43-45-70(131)46-44-68)116-88(135)60-113-92(138)66(8)115-102(148)83(62-129)126-100(146)82(57-85(108)132)124-98(144)79(54-65(6)7)125-104(150)90(67(9)130)127-101(147)81(117-87(134)59-110-10)56-69-58-112-72-36-25-24-35-71(69)72/h24-25,35-36,43-46,58,63-67,73-84,90,110,112,129-131H,11-23,26-34,37-42,47-57,59-62,105-107H2,1-10H3,(H2,108,132)(H2,109,137)(H,111,133)(H,113,138)(H,114,139)(H,115,148)(H,116,135)(H,117,134)(H,118,140)(H,119,142)(H,120,141)(H,121,149)(H,122,143)(H,123,145)(H,124,144)(H,125,150)(H,126,146)(H,127,147)/t66-,67+,73-,74-,75-,76-,77-,78-,79-,80-,81-,82-,83-,84-,90-/m0/s1
Reactome pathway
KEGG

UniProtKB/SwissProt

antibodypedia
GoogleScholar
AffyNet 
CHEMBL
PC cid
PC sid
UniChem
Article
PubMed
3.5n/an/an/an/an/an/an/an/a



University of Utah

Curated by ChEMBL


Assay Description
Displacement of europium-labeled galanin from human GalR1 expressed in HEK293 EBNA cells


J Med Chem 51: 8038-47 (2008)


Article DOI: 10.1021/jm801088x
BindingDB Entry DOI: 10.7270/Q22B8ZXD
More data for this
Ligand-Target Pair
GALR1


(Homo sapiens (Human))
BDBM50307250
PNG
(CHEMBL578514 | GalB2)
Show SMILES CCCCCCCCCCCCCCCC(=O)NCCCC[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)CNC)[C@@H](C)O)C(=O)N[C@@H](CCCCN)C(O)=O |r|
Show InChI InChI=1S/C104H173N23O23/c1-11-12-13-14-15-16-17-18-19-20-21-22-23-42-86(132)110-50-33-29-39-74(95(140)120-76(104(149)150)40-28-32-49-107)118-93(138)73(37-26-30-47-105)117-94(139)75(38-27-31-48-106)119-102(147)84-41-34-51-127(84)89(135)61-113-92(137)77(52-63(2)3)121-96(141)78(53-64(4)5)122-98(143)80(55-68-43-45-70(130)46-44-68)115-88(134)60-112-91(136)66(8)114-101(146)83(62-128)125-99(144)82(57-85(108)131)123-97(142)79(54-65(6)7)124-103(148)90(67(9)129)126-100(145)81(116-87(133)59-109-10)56-69-58-111-72-36-25-24-35-71(69)72/h24-25,35-36,43-46,58,63-67,73-84,90,109,111,128-130H,11-23,26-34,37-42,47-57,59-62,105-107H2,1-10H3,(H2,108,131)(H,110,132)(H,112,136)(H,113,137)(H,114,146)(H,115,134)(H,116,133)(H,117,139)(H,118,138)(H,119,147)(H,120,140)(H,121,141)(H,122,143)(H,123,142)(H,124,148)(H,125,144)(H,126,145)(H,149,150)/t66-,67+,73-,74-,75-,76-,77-,78-,79-,80-,81-,82-,83-,84-,90-/m0/s1
Reactome pathway
KEGG

UniProtKB/SwissProt

antibodypedia
GoogleScholar
AffyNet 
CHEMBL
PC cid
PC sid
UniChem
Article
PubMed
3.5n/an/an/an/an/an/an/an/a



University of Utah

Curated by ChEMBL


Assay Description
Displacement of Eu-labeled galanin from human GalR1 by DELFIA competitive assay


J Med Chem 53: 1871-5 (2010)


Article DOI: 10.1021/jm9018349
BindingDB Entry DOI: 10.7270/Q26D5TXJ
More data for this
Ligand-Target Pair
GALR1


(Homo sapiens (Human))
BDBM50293025
PNG
((Sar)WTLNSAGYLLGPKK(Lys-stearoyl)K | CHEMBL450827)
Show SMILES CCCCCCCCCCCCCCCCCC(=O)NCCCC[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)OC(=O)CNC)[C@@H](C)O)C(=O)N[C@@H](CCCCN)C(N)=O |r|
Show InChI InChI=1S/C106H177N23O23/c1-11-12-13-14-15-16-17-18-19-20-21-22-23-24-25-44-88(134)113-52-35-31-42-77(96(141)119-75(93(111)138)39-28-32-49-107)121-97(142)76(40-29-33-50-108)120-98(143)78(41-30-34-51-109)122-104(149)85-43-36-53-129(85)90(136)62-116-95(140)79(54-65(2)3)123-99(144)80(55-66(4)5)124-101(146)82(57-70-45-47-72(132)48-46-70)118-89(135)61-115-94(139)68(8)117-103(148)84(64-130)127-102(147)83(59-87(110)133)125-100(145)81(56-67(6)7)126-106(151)92(69(9)131)128-105(150)86(152-91(137)63-112-10)58-71-60-114-74-38-27-26-37-73(71)74/h26-27,37-38,45-48,60,65-69,75-86,92,112,114,130-132H,11-25,28-36,39-44,49-59,61-64,107-109H2,1-10H3,(H2,110,133)(H2,111,138)(H,113,134)(H,115,139)(H,116,140)(H,117,148)(H,118,135)(H,119,141)(H,120,143)(H,121,142)(H,122,149)(H,123,144)(H,124,146)(H,125,145)(H,126,151)(H,127,147)(H,128,150)/t68-,69+,75-,76-,77-,78-,79-,80-,81-,82-,83-,84-,85-,86-,92-/m0/s1
Reactome pathway
KEGG

UniProtKB/SwissProt

antibodypedia
GoogleScholar
AffyNet 
CHEMBL
PC cid
PC sid
UniChem
Article
PubMed
4n/an/an/an/an/an/an/an/a



University of Utah

Curated by ChEMBL


Assay Description
Displacement of europium labeled galanin from human recombinant GalR1 receptor by time-resolved fluorescence binding assay


J Med Chem 52: 1310-6 (2009)


Article DOI: 10.1021/jm801397w
BindingDB Entry DOI: 10.7270/Q2FF3SD5
More data for this
Ligand-Target Pair
GALR1


(Homo sapiens (Human))
BDBM50273360
PNG
((S)-N-((S)-6-amino-1-((S)-6-amino-1-((S)-1-((S)-1,...)
Show SMILES CCCCCCCCCCCCCCCC(=O)NCCCC[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)CN)[C@@H](C)O)C(=O)N[C@@H](CCCCN)C(N)=O |r|
Show InChI InChI=1S/C103H172N24O22/c1-10-11-12-13-14-15-16-17-18-19-20-21-22-41-85(132)110-49-32-28-39-74(93(139)117-72(90(109)136)36-25-29-46-104)119-94(140)73(37-26-30-47-105)118-95(141)75(38-27-31-48-106)120-102(148)83-40-33-50-127(83)88(135)60-113-92(138)76(51-62(2)3)121-96(142)77(52-63(4)5)122-98(144)79(54-67-42-44-69(130)45-43-67)116-87(134)59-112-91(137)65(8)114-101(147)82(61-128)125-99(145)81(56-84(108)131)123-97(143)78(53-64(6)7)124-103(149)89(66(9)129)126-100(146)80(115-86(133)57-107)55-68-58-111-71-35-24-23-34-70(68)71/h23-24,34-35,42-45,58,62-66,72-83,89,111,128-130H,10-22,25-33,36-41,46-57,59-61,104-107H2,1-9H3,(H2,108,131)(H2,109,136)(H,110,132)(H,112,137)(H,113,138)(H,114,147)(H,115,133)(H,116,134)(H,117,139)(H,118,141)(H,119,140)(H,120,148)(H,121,142)(H,122,144)(H,123,143)(H,124,149)(H,125,145)(H,126,146)/t65-,66+,72-,73-,74-,75-,76-,77-,78-,79-,80-,81-,82-,83-,89-/m0/s1
Reactome pathway
KEGG

UniProtKB/SwissProt

antibodypedia
GoogleScholar
AffyNet 
CHEMBL
PC cid
PC sid
UniChem
Article
PubMed
5.30n/an/an/an/an/an/an/an/a



University of Utah

Curated by ChEMBL


Assay Description
Displacement of europium-labeled galanin from human GalR1 expressed in HEK293 EBNA cells


J Med Chem 51: 8038-47 (2008)


Article DOI: 10.1021/jm801088x
BindingDB Entry DOI: 10.7270/Q22B8ZXD
More data for this
Ligand-Target Pair
GALR1


(Homo sapiens (Human))
BDBM50273356
PNG
((S)-1-(2-((S)-2-((S)-2-((S)-2-(2-((S)-2-((S)-2-((S...)
Show SMILES CCCCCCCCCCCCCCCC(=O)NCCCC[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)CNC)[C@@H](C)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(N)=O |r|
Show InChI InChI=1S/C104H174N24O22/c1-11-12-13-14-15-16-17-18-19-20-21-22-23-42-86(133)111-50-33-29-40-75(95(141)119-74(38-27-31-48-106)94(140)118-73(91(109)137)37-26-30-47-105)120-96(142)76(39-28-32-49-107)121-103(149)84-41-34-51-128(84)89(136)61-114-93(139)77(52-63(2)3)122-97(143)78(53-64(4)5)123-99(145)80(55-68-43-45-70(131)46-44-68)116-88(135)60-113-92(138)66(8)115-102(148)83(62-129)126-100(146)82(57-85(108)132)124-98(144)79(54-65(6)7)125-104(150)90(67(9)130)127-101(147)81(117-87(134)59-110-10)56-69-58-112-72-36-25-24-35-71(69)72/h24-25,35-36,43-46,58,63-67,73-84,90,110,112,129-131H,11-23,26-34,37-42,47-57,59-62,105-107H2,1-10H3,(H2,108,132)(H2,109,137)(H,111,133)(H,113,138)(H,114,139)(H,115,148)(H,116,135)(H,117,134)(H,118,140)(H,119,141)(H,120,142)(H,121,149)(H,122,143)(H,123,145)(H,124,144)(H,125,150)(H,126,146)(H,127,147)/t66-,67+,73-,74-,75-,76-,77-,78-,79-,80-,81-,82-,83-,84-,90-/m0/s1
Reactome pathway
KEGG

UniProtKB/SwissProt

antibodypedia
GoogleScholar
AffyNet 
CHEMBL
PC cid
PC sid
UniChem
Article
PubMed
6n/an/an/an/an/an/an/an/a



University of Utah

Curated by ChEMBL


Assay Description
Displacement of europium-labeled galanin from human GalR1 expressed in HEK293 EBNA cells


J Med Chem 51: 8038-47 (2008)


Article DOI: 10.1021/jm801088x
BindingDB Entry DOI: 10.7270/Q22B8ZXD
More data for this
Ligand-Target Pair
Galanin receptor 2


(Homo sapiens (Human))
BDBM50307253
PNG
(CHEMBL592415 | WTLNSAGYLLGPHAVGNHPSFSDKNGLTS-CONH2)
Show SMILES CC(C)C[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@@H](N)Cc1c[nH]c2ccccc12)[C@@H](C)O)C(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](Cc1cnc[nH]1)C(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](Cc1cnc[nH]1)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CO)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(O)=O |r,wU:63.64,51.56,37.40,8.12,92.95,107.111,118.122,136.141,153.158,170.176,187.193,199.205,214.220,wD:59.60,75.79,43.48,32.33,16.25,4.4,88.92,102.107,126.130,147.152,164.170,178.184,207.213,208.216,(42.1,-65.81,;41.31,-64.49,;42.06,-63.14,;39.77,-64.51,;38.98,-63.18,;37.44,-63.2,;36.67,-64.54,;37.47,-65.87,;35.13,-64.56,;34.34,-63.22,;35.1,-61.88,;34.32,-60.55,;36.64,-61.87,;34.38,-65.91,;32.83,-65.91,;32.05,-64.59,;32.08,-67.27,;32.86,-68.6,;34.41,-68.58,;35.16,-67.23,;36.69,-67.22,;37.49,-68.54,;39.03,-68.52,;36.72,-69.88,;35.19,-69.9,;30.54,-67.28,;29.78,-68.62,;30.58,-69.95,;28.24,-68.64,;27.47,-69.98,;25.93,-70,;25.14,-68.67,;25.19,-71.35,;25.97,-72.68,;23.63,-71.36,;22.88,-72.71,;23.67,-74.04,;21.34,-72.73,;20.55,-71.39,;21.3,-70.06,;20.58,-74.07,;19.03,-74.09,;18.24,-72.76,;18.28,-75.44,;19.06,-76.76,;20.6,-76.74,;21.36,-75.4,;21.4,-78.07,;16.74,-75.44,;15.97,-76.8,;16.77,-78.11,;14.43,-76.8,;13.65,-75.48,;14.41,-74.14,;13.62,-72.81,;15.95,-74.12,;13.67,-78.15,;12.12,-78.18,;11.35,-76.84,;11.38,-79.52,;9.84,-79.53,;9.07,-80.88,;9.86,-82.2,;7.53,-80.9,;6.77,-82.24,;6.75,-79.57,;7.5,-78.23,;9.04,-78.04,;9.34,-76.54,;8,-75.79,;7.66,-74.29,;6.18,-73.82,;5.05,-74.86,;5.4,-76.36,;6.85,-76.82,;12.16,-80.84,;11.4,-82.18,;13.7,-80.83,;39.73,-61.84,;38.95,-60.5,;41.27,-61.81,;42.03,-60.47,;43.57,-60.45,;44.36,-61.77,;44.33,-59.11,;45.97,-59.47,;46.84,-58.04,;45.74,-56.77,;44.43,-57.6,;43.09,-56.83,;41.75,-57.6,;43.09,-55.29,;41.76,-54.52,;40.44,-55.29,;39.08,-54.51,;38.95,-52.96,;37.43,-52.64,;36.66,-53.95,;37.69,-55.11,;41.76,-52.96,;43.12,-52.19,;40.44,-52.2,;40.44,-50.66,;41.79,-49.86,;39.11,-49.89,;37.78,-50.66,;39.11,-48.32,;37.78,-47.57,;36.47,-48.32,;35.12,-47.55,;36.47,-49.85,;37.78,-46.02,;39.14,-45.22,;36.47,-45.25,;36.47,-43.68,;35.15,-42.92,;33.83,-43.68,;35.15,-41.37,;33.83,-40.6,;32.5,-41.37,;31.15,-40.58,;31.15,-39.02,;29.83,-41.33,;33.83,-39.04,;35.17,-38.25,;32.5,-38.28,;32.5,-36.71,;33.85,-35.93,;33.85,-34.41,;32.63,-33.49,;33.12,-32.04,;34.66,-32.05,;35.12,-33.52,;31.17,-35.94,;29.86,-36.71,;31.17,-34.39,;29.86,-33.64,;28.53,-34.39,;27.18,-33.61,;25.85,-34.38,;24.51,-33.59,;23.19,-34.36,;23.19,-35.9,;21.84,-33.57,;29.86,-32.06,;31.2,-31.29,;28.53,-31.3,;28.53,-29.75,;29.87,-28.97,;29.87,-27.44,;27.21,-28.98,;25.88,-29.75,;27.21,-27.41,;25.88,-26.66,;24.57,-27.41,;23.21,-26.65,;23.23,-25.1,;21.9,-24.32,;20.56,-25.08,;20.55,-26.62,;21.89,-27.4,;25.88,-25.11,;27.23,-24.32,;24.57,-24.33,;24.57,-22.77,;25.92,-22,;25.92,-20.47,;23.24,-22.01,;21.91,-22.77,;23.24,-20.46,;21.91,-19.69,;20.59,-20.46,;19.25,-19.68,;19.25,-18.12,;17.92,-20.45,;21.91,-18.13,;23.27,-17.36,;20.59,-17.37,;20.59,-15.82,;21.95,-15.04,;21.95,-13.51,;23.29,-12.73,;23.29,-11.2,;24.64,-10.42,;19.26,-15.05,;17.95,-15.82,;19.26,-13.48,;17.95,-12.73,;16.62,-13.48,;15.27,-12.71,;15.27,-11.16,;13.96,-13.47,;17.95,-11.17,;19.29,-10.39,;16.62,-10.4,;16.62,-8.84,;15.3,-8.08,;13.97,-8.84,;15.3,-6.53,;13.97,-5.76,;12.66,-6.53,;11.31,-5.75,;9.98,-6.52,;11.31,-4.18,;13.97,-4.2,;15.33,-3.43,;12.66,-3.44,;12.66,-1.89,;14,-1.1,;15.36,-1.89,;14,.42,;11.33,-1.12,;10.01,-1.89,;11.33,.45,;10.01,1.21,;8.68,.45,;7.34,1.22,;10.01,2.76,;8.68,3.53,;11.35,3.54,)|
Show InChI InChI=1S/C137H207N41O42/c1-64(2)38-84(162-120(203)86(40-66(5)6)163-122(205)88(43-74-31-33-78(185)34-32-74)158-104(189)54-149-112(195)69(11)155-129(212)96(58-179)172-126(209)94(49-103(142)188)167-121(204)87(41-67(7)8)170-134(217)110(71(13)183)176-114(197)80(139)44-75-51-148-81-27-19-18-26-79(75)81)115(198)152-57-107(192)178-37-23-30-100(178)132(215)169-90(45-76-52-145-62-153-76)119(202)156-70(12)113(196)175-109(68(9)10)133(216)151-56-106(191)159-93(48-102(141)187)125(208)165-91(46-77-53-146-63-154-77)124(207)161-83(29-22-36-147-137(143)144)118(201)171-97(59-180)130(213)164-89(42-73-24-16-15-17-25-73)123(206)173-98(60-181)131(214)168-95(50-108(193)194)127(210)160-82(28-20-21-35-138)117(200)166-92(47-101(140)186)116(199)150-55-105(190)157-85(39-65(3)4)128(211)177-111(72(14)184)135(218)174-99(61-182)136(219)220/h15-19,24-27,31-34,51-53,62-72,80,82-100,109-111,148,179-185H,20-23,28-30,35-50,54-61,138-139H2,1-14H3,(H2,140,186)(H2,141,187)(H2,142,188)(H,145,153)(H,146,154)(H,149,195)(H,150,199)(H,151,216)(H,152,198)(H,155,212)(H,156,202)(H,157,190)(H,158,189)(H,159,191)(H,160,210)(H,161,207)(H,162,203)(H,163,205)(H,164,213)(H,165,208)(H,166,200)(H,167,204)(H,168,214)(H,169,215)(H,170,217)(H,171,201)(H,172,209)(H,173,206)(H,174,218)(H,175,196)(H,176,197)(H,177,211)(H,193,194)(H,219,220)(H4,143,144,147)/t69-,70-,71+,72+,80-,82-,83-,84-,85-,86-,87-,88-,89-,90-,91-,92-,93-,94-,95-,96-,97-,98-,99-,100-,109-,110-,111-/m0/s1
Reactome pathway
KEGG

UniProtKB/SwissProt

antibodypedia
GoogleScholar
AffyNet 
CHEMBL
PC cid
PC sid
UniChem
Article
PubMed
9.80n/an/an/an/an/an/an/an/a



University of Utah

Curated by ChEMBL


Assay Description
Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assay


J Med Chem 53: 1871-5 (2010)


Article DOI: 10.1021/jm9018349
BindingDB Entry DOI: 10.7270/Q26D5TXJ
More data for this
Ligand-Target Pair
GALR1


(Homo sapiens (Human))
BDBM50307257
PNG
(CHEMBL578910 | [Sar1Ala]GAL-B2)
Show SMILES CCCCCCCCCCCCCCCC(=O)NCCCC[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](C)N)[C@@H](C)O)C(=O)N[C@@H](CCCCN)C(N)=O |r|
Show InChI InChI=1S/C104H174N24O22/c1-11-12-13-14-15-16-17-18-19-20-21-22-23-42-86(133)111-50-33-29-40-75(94(140)117-73(90(110)136)37-26-30-47-105)119-95(141)74(38-27-31-48-106)118-96(142)76(39-28-32-49-107)120-103(149)84-41-34-51-128(84)88(135)60-114-93(139)77(52-62(2)3)122-97(143)78(53-63(4)5)123-99(145)80(55-68-43-45-70(131)46-44-68)116-87(134)59-113-92(138)66(9)115-102(148)83(61-129)126-100(146)82(57-85(109)132)124-98(144)79(54-64(6)7)125-104(150)89(67(10)130)127-101(147)81(121-91(137)65(8)108)56-69-58-112-72-36-25-24-35-71(69)72/h24-25,35-36,43-46,58,62-67,73-84,89,112,129-131H,11-23,26-34,37-42,47-57,59-61,105-108H2,1-10H3,(H2,109,132)(H2,110,136)(H,111,133)(H,113,138)(H,114,139)(H,115,148)(H,116,134)(H,117,140)(H,118,142)(H,119,141)(H,120,149)(H,121,137)(H,122,143)(H,123,145)(H,124,144)(H,125,150)(H,126,146)(H,127,147)/t65-,66-,67+,73-,74-,75-,76-,77-,78-,79-,80-,81-,82-,83-,84-,89-/m0/s1
Reactome pathway
KEGG

UniProtKB/SwissProt

antibodypedia
GoogleScholar
AffyNet 
CHEMBL
KEGG
PC cid
PC sid
UniChem
Article
PubMed
11n/an/an/an/an/an/an/an/a



University of Utah

Curated by ChEMBL


Assay Description
Displacement of Eu-labeled galanin from human GalR1 by DELFIA competitive assay


J Med Chem 53: 1871-5 (2010)


Article DOI: 10.1021/jm9018349
BindingDB Entry DOI: 10.7270/Q26D5TXJ
More data for this
Ligand-Target Pair
Galanin receptor 2


(Homo sapiens (Human))
BDBM50273351
PNG
(CHEMBL508083 | GWTLNSAGYLLGPHAV-NH2)
Show SMILES CC(C)C[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)CN)[C@@H](C)O)C(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](Cc1cnc[nH]1)C(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(N)=O |r|
Show InChI InChI=1S/C77H115N21O20/c1-37(2)23-50(68(109)84-34-62(105)98-22-14-17-58(98)76(117)93-55(28-46-32-81-36-85-46)69(110)87-42(10)67(108)96-63(40(7)8)65(80)106)90-70(111)51(24-38(3)4)91-72(113)53(26-44-18-20-47(101)21-19-44)89-61(104)33-83-66(107)41(9)86-75(116)57(35-99)95-73(114)56(29-59(79)102)92-71(112)52(25-39(5)6)94-77(118)64(43(11)100)97-74(115)54(88-60(103)30-78)27-45-31-82-49-16-13-12-15-48(45)49/h12-13,15-16,18-21,31-32,36-43,50-58,63-64,82,99-101H,14,17,22-30,33-35,78H2,1-11H3,(H2,79,102)(H2,80,106)(H,81,85)(H,83,107)(H,84,109)(H,86,116)(H,87,110)(H,88,103)(H,89,104)(H,90,111)(H,91,113)(H,92,112)(H,93,117)(H,94,118)(H,95,114)(H,96,108)(H,97,115)/t41-,42-,43+,50-,51-,52-,53-,54-,55-,56-,57-,58-,63-,64-/m0/s1
Reactome pathway
KEGG

UniProtKB/SwissProt

antibodypedia
GoogleScholar
AffyNet 
CHEMBL
PC cid
PC sid
UniChem
Article
PubMed
13n/an/an/an/an/an/an/an/a



University of Utah

Curated by ChEMBL


Assay Description
Displacement of europium-labeled galanin from human GalR2 expressed in CHO-K1 cells


J Med Chem 51: 8038-47 (2008)


Article DOI: 10.1021/jm801088x
BindingDB Entry DOI: 10.7270/Q22B8ZXD
More data for this
Ligand-Target Pair
Galanin receptor 2


(Homo sapiens (Human))
BDBM50293029
PNG
((Sar)WTLNSAGYLLGPKK(Lys-decanoyl)K | CHEMBL460706)
Show SMILES CCCCCCCCCC(=O)NCCCC[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)OC(=O)CNC)[C@@H](C)O)C(=O)N[C@@H](CCCCN)C(N)=O |r|
Show InChI InChI=1S/C98H161N23O23/c1-11-12-13-14-15-16-17-36-80(126)105-44-27-23-34-69(88(133)111-67(85(103)130)31-20-24-41-99)113-89(134)68(32-21-25-42-100)112-90(135)70(33-22-26-43-101)114-96(141)77-35-28-45-121(77)82(128)54-108-87(132)71(46-57(2)3)115-91(136)72(47-58(4)5)116-93(138)74(49-62-37-39-64(124)40-38-62)110-81(127)53-107-86(131)60(8)109-95(140)76(56-122)119-94(139)75(51-79(102)125)117-92(137)73(48-59(6)7)118-98(143)84(61(9)123)120-97(142)78(144-83(129)55-104-10)50-63-52-106-66-30-19-18-29-65(63)66/h18-19,29-30,37-40,52,57-61,67-78,84,104,106,122-124H,11-17,20-28,31-36,41-51,53-56,99-101H2,1-10H3,(H2,102,125)(H2,103,130)(H,105,126)(H,107,131)(H,108,132)(H,109,140)(H,110,127)(H,111,133)(H,112,135)(H,113,134)(H,114,141)(H,115,136)(H,116,138)(H,117,137)(H,118,143)(H,119,139)(H,120,142)/t60-,61+,67-,68-,69-,70-,71-,72-,73-,74-,75-,76-,77-,78-,84-/m0/s1
Reactome pathway
KEGG

UniProtKB/SwissProt

antibodypedia
GoogleScholar
AffyNet 
CHEMBL
PC cid
PC sid
UniChem
Article
PubMed
14n/an/an/an/an/an/an/an/a



University of Utah

Curated by ChEMBL


Assay Description
Displacement of europium labeled galanin from human recombinant GalR2 receptor by time-resolved fluorescence binding assay


J Med Chem 52: 1310-6 (2009)


Article DOI: 10.1021/jm801397w
BindingDB Entry DOI: 10.7270/Q2FF3SD5
More data for this
Ligand-Target Pair
Galanin receptor 2


(Homo sapiens (Human))
BDBM50273359
PNG
((R)-1-(2-((S)-2-((S)-2-((S)-2-(2-((S)-2-((S)-2-((S...)
Show SMILES CCCCCCCCCCCCCCCC(=O)NCCCC[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@@H](CCCCN)NC(=O)[C@H]1CCCN1C(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)CNC)[C@@H](C)O)C(=O)N[C@@H](CCCCN)C(N)=O |r|
Show InChI InChI=1S/C104H174N24O22/c1-11-12-13-14-15-16-17-18-19-20-21-22-23-42-86(133)111-50-33-29-40-75(94(140)118-73(91(109)137)37-26-30-47-105)120-95(141)74(38-27-31-48-106)119-96(142)76(39-28-32-49-107)121-103(149)84-41-34-51-128(84)89(136)61-114-93(139)77(52-63(2)3)122-97(143)78(53-64(4)5)123-99(145)80(55-68-43-45-70(131)46-44-68)116-88(135)60-113-92(138)66(8)115-102(148)83(62-129)126-100(146)82(57-85(108)132)124-98(144)79(54-65(6)7)125-104(150)90(67(9)130)127-101(147)81(117-87(134)59-110-10)56-69-58-112-72-36-25-24-35-71(69)72/h24-25,35-36,43-46,58,63-67,73-84,90,110,112,129-131H,11-23,26-34,37-42,47-57,59-62,105-107H2,1-10H3,(H2,108,132)(H2,109,137)(H,111,133)(H,113,138)(H,114,139)(H,115,148)(H,116,135)(H,117,134)(H,118,140)(H,119,142)(H,120,141)(H,121,149)(H,122,143)(H,123,145)(H,124,144)(H,125,150)(H,126,146)(H,127,147)/t66-,67+,73-,74-,75+,76+,77-,78-,79-,80-,81-,82-,83-,84+,90-/m0/s1
Reactome pathway
KEGG

UniProtKB/SwissProt

antibodypedia
GoogleScholar
AffyNet 
CHEMBL
PC cid
PC sid
UniChem
Article
PubMed
15n/an/an/an/an/an/an/an/a



University of Utah

Curated by ChEMBL


Assay Description
Displacement of europium-labeled galanin from human GalR2 expressed in CHO-K1 cells


J Med Chem 51: 8038-47 (2008)


Article DOI: 10.1021/jm801088x
BindingDB Entry DOI: 10.7270/Q22B8ZXD
More data for this
Ligand-Target Pair
Galanin receptor 2


(Homo sapiens (Human))
BDBM50293030
PNG
((Sar)WTLNSAGYLLGPKK(Lys-octanoyl)K | CHEMBL503900)
Show SMILES CCCCCCCC(=O)NCCCC[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)OC(=O)CNC)[C@@H](C)O)C(=O)N[C@@H](CCCCN)C(N)=O |r|
Show InChI InChI=1S/C96H157N23O23/c1-11-12-13-14-15-34-78(124)103-42-25-21-32-67(86(131)109-65(83(101)128)29-18-22-39-97)111-87(132)66(30-19-23-40-98)110-88(133)68(31-20-24-41-99)112-94(139)75-33-26-43-119(75)80(126)52-106-85(130)69(44-55(2)3)113-89(134)70(45-56(4)5)114-91(136)72(47-60-35-37-62(122)38-36-60)108-79(125)51-105-84(129)58(8)107-93(138)74(54-120)117-92(137)73(49-77(100)123)115-90(135)71(46-57(6)7)116-96(141)82(59(9)121)118-95(140)76(142-81(127)53-102-10)48-61-50-104-64-28-17-16-27-63(61)64/h16-17,27-28,35-38,50,55-59,65-76,82,102,104,120-122H,11-15,18-26,29-34,39-49,51-54,97-99H2,1-10H3,(H2,100,123)(H2,101,128)(H,103,124)(H,105,129)(H,106,130)(H,107,138)(H,108,125)(H,109,131)(H,110,133)(H,111,132)(H,112,139)(H,113,134)(H,114,136)(H,115,135)(H,116,141)(H,117,137)(H,118,140)/t58-,59+,65-,66-,67-,68-,69-,70-,71-,72-,73-,74-,75-,76-,82-/m0/s1
Reactome pathway
KEGG

UniProtKB/SwissProt

antibodypedia
GoogleScholar
AffyNet 
CHEMBL
KEGG
PC cid
PC sid
UniChem
Article
PubMed
15n/an/an/an/an/an/an/an/a



University of Utah

Curated by ChEMBL


Assay Description
Displacement of europium labeled galanin from human recombinant GalR2 receptor by time-resolved fluorescence binding assay


J Med Chem 52: 1310-6 (2009)


Article DOI: 10.1021/jm801397w
BindingDB Entry DOI: 10.7270/Q2FF3SD5
More data for this
Ligand-Target Pair
Galanin receptor 2


(Homo sapiens (Human))
BDBM50293025
PNG
((Sar)WTLNSAGYLLGPKK(Lys-stearoyl)K | CHEMBL450827)
Show SMILES CCCCCCCCCCCCCCCCCC(=O)NCCCC[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)OC(=O)CNC)[C@@H](C)O)C(=O)N[C@@H](CCCCN)C(N)=O |r|
Show InChI InChI=1S/C106H177N23O23/c1-11-12-13-14-15-16-17-18-19-20-21-22-23-24-25-44-88(134)113-52-35-31-42-77(96(141)119-75(93(111)138)39-28-32-49-107)121-97(142)76(40-29-33-50-108)120-98(143)78(41-30-34-51-109)122-104(149)85-43-36-53-129(85)90(136)62-116-95(140)79(54-65(2)3)123-99(144)80(55-66(4)5)124-101(146)82(57-70-45-47-72(132)48-46-70)118-89(135)61-115-94(139)68(8)117-103(148)84(64-130)127-102(147)83(59-87(110)133)125-100(145)81(56-67(6)7)126-106(151)92(69(9)131)128-105(150)86(152-91(137)63-112-10)58-71-60-114-74-38-27-26-37-73(71)74/h26-27,37-38,45-48,60,65-69,75-86,92,112,114,130-132H,11-25,28-36,39-44,49-59,61-64,107-109H2,1-10H3,(H2,110,133)(H2,111,138)(H,113,134)(H,115,139)(H,116,140)(H,117,148)(H,118,135)(H,119,141)(H,120,143)(H,121,142)(H,122,149)(H,123,144)(H,124,146)(H,125,145)(H,126,151)(H,127,147)(H,128,150)/t68-,69+,75-,76-,77-,78-,79-,80-,81-,82-,83-,84-,85-,86-,92-/m0/s1
Reactome pathway
KEGG

UniProtKB/SwissProt

antibodypedia
GoogleScholar
AffyNet 
CHEMBL
PC cid
PC sid
UniChem
Article
PubMed
15n/an/an/an/an/an/an/an/a



University of Utah

Curated by ChEMBL


Assay Description
Displacement of europium labeled galanin from human recombinant GalR2 receptor by time-resolved fluorescence binding assay


J Med Chem 52: 1310-6 (2009)


Article DOI: 10.1021/jm801397w
BindingDB Entry DOI: 10.7270/Q2FF3SD5
More data for this
Ligand-Target Pair
Galanin receptor 2


(Homo sapiens (Human))
BDBM50293028
PNG
((Sar)WTLNSAGYLLGPKK(Lys-lauroyl)K | CHEMBL507733)
Show SMILES CCCCCCCCCCCC(=O)NCCCC[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)OC(=O)CNC)[C@@H](C)O)C(=O)N[C@@H](CCCCN)C(N)=O |r|
Show InChI InChI=1S/C100H165N23O23/c1-11-12-13-14-15-16-17-18-19-38-82(128)107-46-29-25-36-71(90(135)113-69(87(105)132)33-22-26-43-101)115-91(136)70(34-23-27-44-102)114-92(137)72(35-24-28-45-103)116-98(143)79-37-30-47-123(79)84(130)56-110-89(134)73(48-59(2)3)117-93(138)74(49-60(4)5)118-95(140)76(51-64-39-41-66(126)42-40-64)112-83(129)55-109-88(133)62(8)111-97(142)78(58-124)121-96(141)77(53-81(104)127)119-94(139)75(50-61(6)7)120-100(145)86(63(9)125)122-99(144)80(146-85(131)57-106-10)52-65-54-108-68-32-21-20-31-67(65)68/h20-21,31-32,39-42,54,59-63,69-80,86,106,108,124-126H,11-19,22-30,33-38,43-53,55-58,101-103H2,1-10H3,(H2,104,127)(H2,105,132)(H,107,128)(H,109,133)(H,110,134)(H,111,142)(H,112,129)(H,113,135)(H,114,137)(H,115,136)(H,116,143)(H,117,138)(H,118,140)(H,119,139)(H,120,145)(H,121,141)(H,122,144)/t62-,63+,69-,70-,71-,72-,73-,74-,75-,76-,77-,78-,79-,80-,86-/m0/s1
Reactome pathway
KEGG

UniProtKB/SwissProt

antibodypedia
GoogleScholar
AffyNet 
CHEMBL
PC cid
PC sid
UniChem
Article
PubMed
16n/an/an/an/an/an/an/an/a



University of Utah

Curated by ChEMBL


Assay Description
Displacement of europium labeled galanin from human recombinant GalR2 receptor by time-resolved fluorescence binding assay


J Med Chem 52: 1310-6 (2009)


Article DOI: 10.1021/jm801397w
BindingDB Entry DOI: 10.7270/Q2FF3SD5
More data for this
Ligand-Target Pair
Galanin receptor 2


(Homo sapiens (Human))
BDBM50307258
PNG
(CHEMBL578317 | [N-Ac,des-Sar]Gal-B2)
Show SMILES CCCCCCCCCCCCCCCC(=O)NCCCC[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(C)=O)[C@@H](C)O)C(=O)N[C@@H](CCCCN)C(N)=O |r|
Show InChI InChI=1S/C103H171N23O22/c1-11-12-13-14-15-16-17-18-19-20-21-22-23-42-86(132)109-50-33-29-40-75(93(138)116-73(90(108)135)37-26-30-47-104)118-94(139)74(38-27-31-48-105)117-95(140)76(39-28-32-49-106)119-102(147)84-41-34-51-126(84)88(134)60-112-92(137)77(52-62(2)3)120-96(141)78(53-63(4)5)121-98(143)80(55-68-43-45-70(130)46-44-68)115-87(133)59-111-91(136)65(8)113-101(146)83(61-127)124-99(144)82(57-85(107)131)122-97(142)79(54-64(6)7)123-103(148)89(66(9)128)125-100(145)81(114-67(10)129)56-69-58-110-72-36-25-24-35-71(69)72/h24-25,35-36,43-46,58,62-66,73-84,89,110,127-128,130H,11-23,26-34,37-42,47-57,59-61,104-106H2,1-10H3,(H2,107,131)(H2,108,135)(H,109,132)(H,111,136)(H,112,137)(H,113,146)(H,114,129)(H,115,133)(H,116,138)(H,117,140)(H,118,139)(H,119,147)(H,120,141)(H,121,143)(H,122,142)(H,123,148)(H,124,144)(H,125,145)/t65-,66+,73-,74-,75-,76-,77-,78-,79-,80-,81-,82-,83-,84-,89-/m0/s1
Reactome pathway
KEGG

UniProtKB/SwissProt

antibodypedia
GoogleScholar
AffyNet 
CHEMBL
PC cid
PC sid
UniChem
Article
PubMed
16n/an/an/an/an/an/an/an/a



University of Utah

Curated by ChEMBL


Assay Description
Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assay


J Med Chem 53: 1871-5 (2010)


Article DOI: 10.1021/jm9018349
BindingDB Entry DOI: 10.7270/Q26D5TXJ
More data for this
Ligand-Target Pair
Galanin receptor 2


(Homo sapiens (Human))
BDBM50273360
PNG
((S)-N-((S)-6-amino-1-((S)-6-amino-1-((S)-1-((S)-1,...)
Show SMILES CCCCCCCCCCCCCCCC(=O)NCCCC[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)CN)[C@@H](C)O)C(=O)N[C@@H](CCCCN)C(N)=O |r|
Show InChI InChI=1S/C103H172N24O22/c1-10-11-12-13-14-15-16-17-18-19-20-21-22-41-85(132)110-49-32-28-39-74(93(139)117-72(90(109)136)36-25-29-46-104)119-94(140)73(37-26-30-47-105)118-95(141)75(38-27-31-48-106)120-102(148)83-40-33-50-127(83)88(135)60-113-92(138)76(51-62(2)3)121-96(142)77(52-63(4)5)122-98(144)79(54-67-42-44-69(130)45-43-67)116-87(134)59-112-91(137)65(8)114-101(147)82(61-128)125-99(145)81(56-84(108)131)123-97(143)78(53-64(6)7)124-103(149)89(66(9)129)126-100(146)80(115-86(133)57-107)55-68-58-111-71-35-24-23-34-70(68)71/h23-24,34-35,42-45,58,62-66,72-83,89,111,128-130H,10-22,25-33,36-41,46-57,59-61,104-107H2,1-9H3,(H2,108,131)(H2,109,136)(H,110,132)(H,112,137)(H,113,138)(H,114,147)(H,115,133)(H,116,134)(H,117,139)(H,118,141)(H,119,140)(H,120,148)(H,121,142)(H,122,144)(H,123,143)(H,124,149)(H,125,145)(H,126,146)/t65-,66+,72-,73-,74-,75-,76-,77-,78-,79-,80-,81-,82-,83-,89-/m0/s1
Reactome pathway
KEGG

UniProtKB/SwissProt

antibodypedia
GoogleScholar
AffyNet 
CHEMBL
PC cid
PC sid
UniChem
Article
PubMed
18n/an/an/an/an/an/an/an/a



University of Utah

Curated by ChEMBL


Assay Description
Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assay


J Med Chem 53: 1871-5 (2010)


Article DOI: 10.1021/jm9018349
BindingDB Entry DOI: 10.7270/Q26D5TXJ
More data for this
Ligand-Target Pair
Galanin receptor 2


(Homo sapiens (Human))
BDBM50293027
PNG
((Sar)WTLNSAGYLLGPKK(Lys-myristoyl)K | CHEMBL524678)
Show SMILES CCCCCCCCCCCCCC(=O)NCCCC[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)OC(=O)CNC)[C@@H](C)O)C(=O)N[C@@H](CCCCN)C(N)=O |r|
Show InChI InChI=1S/C102H169N23O23/c1-11-12-13-14-15-16-17-18-19-20-21-40-84(130)109-48-31-27-38-73(92(137)115-71(89(107)134)35-24-28-45-103)117-93(138)72(36-25-29-46-104)116-94(139)74(37-26-30-47-105)118-100(145)81-39-32-49-125(81)86(132)58-112-91(136)75(50-61(2)3)119-95(140)76(51-62(4)5)120-97(142)78(53-66-41-43-68(128)44-42-66)114-85(131)57-111-90(135)64(8)113-99(144)80(60-126)123-98(143)79(55-83(106)129)121-96(141)77(52-63(6)7)122-102(147)88(65(9)127)124-101(146)82(148-87(133)59-108-10)54-67-56-110-70-34-23-22-33-69(67)70/h22-23,33-34,41-44,56,61-65,71-82,88,108,110,126-128H,11-21,24-32,35-40,45-55,57-60,103-105H2,1-10H3,(H2,106,129)(H2,107,134)(H,109,130)(H,111,135)(H,112,136)(H,113,144)(H,114,131)(H,115,137)(H,116,139)(H,117,138)(H,118,145)(H,119,140)(H,120,142)(H,121,141)(H,122,147)(H,123,143)(H,124,146)/t64-,65+,71-,72-,73-,74-,75-,76-,77-,78-,79-,80-,81-,82-,88-/m0/s1
Reactome pathway
KEGG

UniProtKB/SwissProt

antibodypedia
GoogleScholar
AffyNet 
CHEMBL
PC cid
PC sid
UniChem
Article
PubMed
18n/an/an/an/an/an/an/an/a



University of Utah

Curated by ChEMBL


Assay Description
Displacement of europium labeled galanin from human recombinant GalR2 receptor by time-resolved fluorescence binding assay


J Med Chem 52: 1310-6 (2009)


Article DOI: 10.1021/jm801397w
BindingDB Entry DOI: 10.7270/Q2FF3SD5
More data for this
Ligand-Target Pair
Galanin receptor 2


(Homo sapiens (Human))
BDBM50307259
PNG
(CHEMBL604991 | [N-Me,des-Sar]Gal-B2)
Show SMILES CCCCCCCCCCCCCCCC(=O)NCCCC[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC)[C@@H](C)O)C(=O)N[C@@H](CCCCN)C(N)=O |r|
Show InChI InChI=1S/C102H171N23O21/c1-11-12-13-14-15-16-17-18-19-20-21-22-23-42-85(130)109-50-33-29-40-74(92(136)115-72(89(107)133)37-26-30-47-103)117-93(137)73(38-27-31-48-104)116-94(138)75(39-28-32-49-105)118-101(145)83-41-34-51-125(83)87(132)60-112-91(135)77(52-62(2)3)119-96(140)78(53-63(4)5)120-98(142)80(55-67-43-45-69(128)46-44-67)114-86(131)59-111-90(134)65(8)113-100(144)82(61-126)123-99(143)81(57-84(106)129)121-97(141)79(54-64(6)7)122-102(146)88(66(9)127)124-95(139)76(108-10)56-68-58-110-71-36-25-24-35-70(68)71/h24-25,35-36,43-46,58,62-66,72-83,88,108,110,126-128H,11-23,26-34,37-42,47-57,59-61,103-105H2,1-10H3,(H2,106,129)(H2,107,133)(H,109,130)(H,111,134)(H,112,135)(H,113,144)(H,114,131)(H,115,136)(H,116,138)(H,117,137)(H,118,145)(H,119,140)(H,120,142)(H,121,141)(H,122,146)(H,123,143)(H,124,139)/t65-,66+,72-,73-,74-,75-,76-,77-,78-,79-,80-,81-,82-,83-,88-/m0/s1
Reactome pathway
KEGG

UniProtKB/SwissProt

antibodypedia
GoogleScholar
AffyNet 
CHEMBL
PC cid
PC sid
UniChem
Article
PubMed
20n/an/an/an/an/an/an/an/a



University of Utah

Curated by ChEMBL


Assay Description
Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assay


J Med Chem 53: 1871-5 (2010)


Article DOI: 10.1021/jm9018349
BindingDB Entry DOI: 10.7270/Q26D5TXJ
More data for this
Ligand-Target Pair
Galanin receptor 2


(Homo sapiens (Human))
BDBM50293024
PNG
((Sar)WTLNSAGYLLGPKK(Lys-MPEG4)K | CHEMBL505299)
Show SMILES CNCC(=O)O[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(=O)NCC(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCNC(=O)COCCOCCOCCOCCOC)C(=O)N[C@@H](CCCCN)C(N)=O |r|
Show InChI InChI=1S/C99H163N23O28/c1-58(2)46-72(88(133)109-54-83(129)122-37-21-28-78(122)97(142)115-71(26-15-19-35-102)91(136)113-69(25-14-18-34-101)90(135)114-70(89(134)112-68(86(104)131)24-13-17-33-100)27-16-20-36-106-82(128)57-149-45-44-148-43-42-147-41-40-146-39-38-145-10)116-92(137)73(47-59(3)4)117-94(139)75(49-63-29-31-65(125)32-30-63)111-81(127)53-108-87(132)61(7)110-96(141)77(56-123)120-95(140)76(51-80(103)126)118-93(138)74(48-60(5)6)119-99(144)85(62(8)124)121-98(143)79(150-84(130)55-105-9)50-64-52-107-67-23-12-11-22-66(64)67/h11-12,22-23,29-32,52,58-62,68-79,85,105,107,123-125H,13-21,24-28,33-51,53-57,100-102H2,1-10H3,(H2,103,126)(H2,104,131)(H,106,128)(H,108,132)(H,109,133)(H,110,141)(H,111,127)(H,112,134)(H,113,136)(H,114,135)(H,115,142)(H,116,137)(H,117,139)(H,118,138)(H,119,144)(H,120,140)(H,121,143)/t61-,62+,68-,69-,70-,71-,72-,73-,74-,75-,76-,77-,78-,79-,85-/m0/s1
Reactome pathway
KEGG

UniProtKB/SwissProt

antibodypedia
GoogleScholar
AffyNet 
CHEMBL
PC cid
PC sid
UniChem
Article
PubMed
21n/an/an/an/an/an/an/an/a



University of Utah

Curated by ChEMBL


Assay Description
Displacement of europium labeled galanin from human recombinant GalR2 receptor by time-resolved fluorescence binding assay


J Med Chem 52: 1310-6 (2009)


Article DOI: 10.1021/jm801397w
BindingDB Entry DOI: 10.7270/Q2FF3SD5
More data for this
Ligand-Target Pair
GALR1


(Homo sapiens (Human))
BDBM50273361
PNG
((S)-N-((S)-6-amino-1-((S)-6-amino-1-((S)-1-((S)-1,...)
Show SMILES CCCCCCCCCCCCCCCC(=O)NCCCC[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)CCCCCN)[C@@H](C)O)C(=O)N[C@@H](CCCCN)C(N)=O |r|
Show InChI InChI=1S/C107H180N24O22/c1-10-11-12-13-14-15-16-17-18-19-20-21-23-44-89(136)114-54-35-30-42-78(97(143)121-76(94(113)140)39-27-32-51-109)123-98(144)77(40-28-33-52-110)122-99(145)79(41-29-34-53-111)124-106(152)87-43-36-55-131(87)92(139)64-117-96(142)80(56-66(2)3)125-100(146)81(57-67(4)5)126-102(148)83(59-71-46-48-73(134)49-47-71)120-91(138)63-116-95(141)69(8)118-105(151)86(65-132)129-103(149)85(61-88(112)135)127-101(147)82(58-68(6)7)128-107(153)93(70(9)133)130-104(150)84(119-90(137)45-24-22-31-50-108)60-72-62-115-75-38-26-25-37-74(72)75/h25-26,37-38,46-49,62,66-70,76-87,93,115,132-134H,10-24,27-36,39-45,50-61,63-65,108-111H2,1-9H3,(H2,112,135)(H2,113,140)(H,114,136)(H,116,141)(H,117,142)(H,118,151)(H,119,137)(H,120,138)(H,121,143)(H,122,145)(H,123,144)(H,124,152)(H,125,146)(H,126,148)(H,127,147)(H,128,153)(H,129,149)(H,130,150)/t69-,70+,76-,77-,78-,79-,80-,81-,82-,83-,84-,85-,86-,87-,93-/m0/s1
Reactome pathway
KEGG

UniProtKB/SwissProt

antibodypedia
GoogleScholar
AffyNet 
CHEMBL
PC cid
PC sid
UniChem
Article
PubMed
22n/an/an/an/an/an/an/an/a



University of Utah

Curated by ChEMBL


Assay Description
Displacement of europium-labeled galanin from human GalR1 expressed in HEK293 EBNA cells


J Med Chem 51: 8038-47 (2008)


Article DOI: 10.1021/jm801088x
BindingDB Entry DOI: 10.7270/Q22B8ZXD
More data for this
Ligand-Target Pair
Galanin receptor 2


(Homo sapiens (Human))
BDBM50273354
PNG
((S)-1-(2-((S)-2-((S)-2-((S)-2-(2-((S)-2-((S)-2-((S...)
Show SMILES CCCCCCCCCCCCCCCC(=O)NCCCC[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)CNC)[C@@H](C)O)C(N)=O |r|
Show InChI InChI=1S/C104H174N24O22/c1-11-12-13-14-15-16-17-18-19-20-21-22-23-42-86(133)111-50-33-29-37-73(91(109)137)118-94(140)74(38-26-30-47-105)119-95(141)75(39-27-31-48-106)120-96(142)76(40-28-32-49-107)121-103(149)84-41-34-51-128(84)89(136)61-114-93(139)77(52-63(2)3)122-97(143)78(53-64(4)5)123-99(145)80(55-68-43-45-70(131)46-44-68)116-88(135)60-113-92(138)66(8)115-102(148)83(62-129)126-100(146)82(57-85(108)132)124-98(144)79(54-65(6)7)125-104(150)90(67(9)130)127-101(147)81(117-87(134)59-110-10)56-69-58-112-72-36-25-24-35-71(69)72/h24-25,35-36,43-46,58,63-67,73-84,90,110,112,129-131H,11-23,26-34,37-42,47-57,59-62,105-107H2,1-10H3,(H2,108,132)(H2,109,137)(H,111,133)(H,113,138)(H,114,139)(H,115,148)(H,116,135)(H,117,134)(H,118,140)(H,119,141)(H,120,142)(H,121,149)(H,122,143)(H,123,145)(H,124,144)(H,125,150)(H,126,146)(H,127,147)/t66-,67+,73-,74-,75-,76-,77-,78-,79-,80-,81-,82-,83-,84-,90-/m0/s1
Reactome pathway
KEGG

UniProtKB/SwissProt

antibodypedia
GoogleScholar
AffyNet 
CHEMBL
PC cid
PC sid
UniChem
Article
PubMed
22n/an/an/an/an/an/an/an/a



University of Utah

Curated by ChEMBL


Assay Description
Displacement of europium-labeled galanin from human GalR2 expressed in CHO-K1 cells


J Med Chem 51: 8038-47 (2008)


Article DOI: 10.1021/jm801088x
BindingDB Entry DOI: 10.7270/Q22B8ZXD
More data for this
Ligand-Target Pair
Galanin receptor 2


(Homo sapiens (Human))
BDBM50273360
PNG
((S)-N-((S)-6-amino-1-((S)-6-amino-1-((S)-1-((S)-1,...)
Show SMILES CCCCCCCCCCCCCCCC(=O)NCCCC[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)CN)[C@@H](C)O)C(=O)N[C@@H](CCCCN)C(N)=O |r|
Show InChI InChI=1S/C103H172N24O22/c1-10-11-12-13-14-15-16-17-18-19-20-21-22-41-85(132)110-49-32-28-39-74(93(139)117-72(90(109)136)36-25-29-46-104)119-94(140)73(37-26-30-47-105)118-95(141)75(38-27-31-48-106)120-102(148)83-40-33-50-127(83)88(135)60-113-92(138)76(51-62(2)3)121-96(142)77(52-63(4)5)122-98(144)79(54-67-42-44-69(130)45-43-67)116-87(134)59-112-91(137)65(8)114-101(147)82(61-128)125-99(145)81(56-84(108)131)123-97(143)78(53-64(6)7)124-103(149)89(66(9)129)126-100(146)80(115-86(133)57-107)55-68-58-111-71-35-24-23-34-70(68)71/h23-24,34-35,42-45,58,62-66,72-83,89,111,128-130H,10-22,25-33,36-41,46-57,59-61,104-107H2,1-9H3,(H2,108,131)(H2,109,136)(H,110,132)(H,112,137)(H,113,138)(H,114,147)(H,115,133)(H,116,134)(H,117,139)(H,118,141)(H,119,140)(H,120,148)(H,121,142)(H,122,144)(H,123,143)(H,124,149)(H,125,145)(H,126,146)/t65-,66+,72-,73-,74-,75-,76-,77-,78-,79-,80-,81-,82-,83-,89-/m0/s1
Reactome pathway
KEGG

UniProtKB/SwissProt

antibodypedia
GoogleScholar
AffyNet 
CHEMBL
PC cid
PC sid
UniChem
Article
PubMed
23n/an/an/an/an/an/an/an/a



University of Utah

Curated by ChEMBL


Assay Description
Displacement of europium-labeled galanin from human GalR2 expressed in CHO-K1 cells


J Med Chem 51: 8038-47 (2008)


Article DOI: 10.1021/jm801088x
BindingDB Entry DOI: 10.7270/Q22B8ZXD
More data for this
Ligand-Target Pair
Galanin receptor 2


(Homo sapiens (Human))
BDBM50293023
PNG
((Sar)WTLNSAGYLLGPKKKK | CHEMBL508036)
Show SMILES CNCC(=O)O[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(=O)NCC(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(N)=O |r|
Show InChI InChI=1S/C88H143N23O22/c1-48(2)37-62(77(121)98-45-72(117)111-36-20-27-68(111)86(130)104-61(26-15-19-35-92)80(124)103-60(25-14-18-34-91)79(123)102-59(24-13-17-33-90)78(122)101-58(75(94)119)23-12-16-32-89)105-81(125)63(38-49(3)4)106-83(127)65(40-53-28-30-55(114)31-29-53)100-71(116)44-97-76(120)51(7)99-85(129)67(47-112)109-84(128)66(42-70(93)115)107-82(126)64(39-50(5)6)108-88(132)74(52(8)113)110-87(131)69(133-73(118)46-95-9)41-54-43-96-57-22-11-10-21-56(54)57/h10-11,21-22,28-31,43,48-52,58-69,74,95-96,112-114H,12-20,23-27,32-42,44-47,89-92H2,1-9H3,(H2,93,115)(H2,94,119)(H,97,120)(H,98,121)(H,99,129)(H,100,116)(H,101,122)(H,102,123)(H,103,124)(H,104,130)(H,105,125)(H,106,127)(H,107,126)(H,108,132)(H,109,128)(H,110,131)/t51-,52+,58-,59-,60-,61-,62-,63-,64-,65-,66-,67-,68-,69-,74-/m0/s1
Reactome pathway
KEGG

UniProtKB/SwissProt

antibodypedia
GoogleScholar
AffyNet 
CHEMBL
PC cid
PC sid
UniChem
Article
PubMed
24n/an/an/an/an/an/an/an/a



University of Utah

Curated by ChEMBL


Assay Description
Displacement of europium labeled galanin from human recombinant GalR2 receptor by time-resolved fluorescence binding assay


J Med Chem 52: 1310-6 (2009)


Article DOI: 10.1021/jm801397w
BindingDB Entry DOI: 10.7270/Q2FF3SD5
More data for this
Ligand-Target Pair
Displayed 1 to 50 (of 104 total )  |  Next  |  Last  >>
Jump to: