Target/Host (Institution) | Ligand | Target/Host Links | Ligand Links | Trg + Lig Links | Ki nM | ΔG° kJ/mole | IC50 nM | Kd nM | EC50/IC50 nM | koff s-1 | kon M-1s-1 | pH | Temp °C |
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
3-phosphoinositide-dependent protein kinase 1 (Homo sapiens (Human)) | BDBM50361648 (CHEMBL1940246) | PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | CHEMBL PC cid PC sid UniChem Similars | Article PubMed | 0.600 | n/a | n/a | n/a | n/a | n/a | n/a | n/a | n/a |
Pfizer Inc. Curated by ChEMBL | Assay Description Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISA | J Med Chem 54: 8490-500 (2011) Article DOI: 10.1021/jm201019k BindingDB Entry DOI: 10.7270/Q23N23TV | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
3-phosphoinositide-dependent protein kinase 1 (Homo sapiens (Human)) | BDBM50361649 (CHEMBL1938415) | PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | CHEMBL MMDB PC cid PC sid PDB UniChem Similars | PDB Article PubMed | 0.600 | n/a | n/a | n/a | n/a | n/a | n/a | n/a | n/a |
Pfizer Inc. Curated by ChEMBL | Assay Description Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISA | J Med Chem 54: 8490-500 (2011) Article DOI: 10.1021/jm201019k BindingDB Entry DOI: 10.7270/Q23N23TV | |||||||||||
More data for this Ligand-Target Pair | 3D Structure (crystal) | ||||||||||||
3-phosphoinositide-dependent protein kinase 1 (Homo sapiens (Human)) | BDBM50361642 (CHEMBL1940251) | PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | CHEMBL PC cid PC sid UniChem Similars | Article PubMed | 0.700 | n/a | n/a | n/a | n/a | n/a | n/a | n/a | n/a |
Pfizer Inc. Curated by ChEMBL | Assay Description Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence... | J Med Chem 54: 8490-500 (2011) Article DOI: 10.1021/jm201019k BindingDB Entry DOI: 10.7270/Q23N23TV | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
3-phosphoinositide-dependent protein kinase 1 (Homo sapiens (Human)) | BDBM50361641 (CHEMBL1940247) | PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | CHEMBL PC cid PC sid UniChem Similars | Article PubMed | 0.900 | n/a | n/a | n/a | n/a | n/a | n/a | n/a | n/a |
Pfizer Inc. Curated by ChEMBL | Assay Description Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISA | J Med Chem 54: 8490-500 (2011) Article DOI: 10.1021/jm201019k BindingDB Entry DOI: 10.7270/Q23N23TV | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
3-phosphoinositide-dependent protein kinase 1 (Homo sapiens (Human)) | BDBM50361652 (CHEMBL1940250) | PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | CHEMBL PC cid PC sid UniChem Similars | Article PubMed | 1 | n/a | n/a | n/a | n/a | n/a | n/a | n/a | n/a |
Pfizer Inc. Curated by ChEMBL | Assay Description Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISA | J Med Chem 54: 8490-500 (2011) Article DOI: 10.1021/jm201019k BindingDB Entry DOI: 10.7270/Q23N23TV | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
3-phosphoinositide-dependent protein kinase 1 (Homo sapiens (Human)) | BDBM50361650 (CHEMBL1940248) | PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | CHEMBL PC cid PC sid UniChem Similars | Article PubMed | 1.30 | n/a | n/a | n/a | n/a | n/a | n/a | n/a | n/a |
Pfizer Inc. Curated by ChEMBL | Assay Description Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISA | J Med Chem 54: 8490-500 (2011) Article DOI: 10.1021/jm201019k BindingDB Entry DOI: 10.7270/Q23N23TV | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
3-phosphoinositide-dependent protein kinase 1 (Homo sapiens (Human)) | BDBM50361644 (CHEMBL1940253) | PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | CHEMBL PC cid PC sid UniChem Similars | Article PubMed | 1.40 | n/a | n/a | n/a | n/a | n/a | n/a | n/a | n/a |
Pfizer Inc. Curated by ChEMBL | Assay Description Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence... | J Med Chem 54: 8490-500 (2011) Article DOI: 10.1021/jm201019k BindingDB Entry DOI: 10.7270/Q23N23TV | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
3-phosphoinositide-dependent protein kinase 1 (Homo sapiens (Human)) | BDBM50361643 (CHEMBL1940252) | PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | CHEMBL PC cid PC sid UniChem Similars | Article PubMed | 1.40 | n/a | n/a | n/a | n/a | n/a | n/a | n/a | n/a |
Pfizer Inc. Curated by ChEMBL | Assay Description Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence... | J Med Chem 54: 8490-500 (2011) Article DOI: 10.1021/jm201019k BindingDB Entry DOI: 10.7270/Q23N23TV | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
3-phosphoinositide-dependent protein kinase 1 (Homo sapiens (Human)) | BDBM50361653 (CHEMBL1940245) | PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | CHEMBL PC cid PC sid UniChem Similars | Article PubMed | 2 | n/a | n/a | n/a | n/a | n/a | n/a | n/a | n/a |
Pfizer Inc. Curated by ChEMBL | Assay Description Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISA | J Med Chem 54: 8490-500 (2011) Article DOI: 10.1021/jm201019k BindingDB Entry DOI: 10.7270/Q23N23TV | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
3-phosphoinositide-dependent protein kinase 1 (Homo sapiens (Human)) | BDBM50361651 (CHEMBL1940249) | PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | CHEMBL PC cid PC sid UniChem Similars | Article PubMed | 2.5 | n/a | n/a | n/a | n/a | n/a | n/a | n/a | n/a |
Pfizer Inc. Curated by ChEMBL | Assay Description Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISA | J Med Chem 54: 8490-500 (2011) Article DOI: 10.1021/jm201019k BindingDB Entry DOI: 10.7270/Q23N23TV | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
3-phosphoinositide-dependent protein kinase 1 (Homo sapiens (Human)) | BDBM50361647 (CHEMBL1940244) | PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | CHEMBL MMDB PC cid PC sid PDB UniChem Similars | PDB Article PubMed | 35 | n/a | n/a | n/a | n/a | n/a | n/a | n/a | n/a |
Pfizer Inc. Curated by ChEMBL | Assay Description Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISA | J Med Chem 54: 8490-500 (2011) Article DOI: 10.1021/jm201019k BindingDB Entry DOI: 10.7270/Q23N23TV | |||||||||||
More data for this Ligand-Target Pair | 3D Structure (crystal) | ||||||||||||
3-phosphoinositide-dependent protein kinase 1 (Homo sapiens (Human)) | BDBM50402020 (CHEMBL2205426) | PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | CHEMBL PC cid PC sid UniChem Similars | Article PubMed | 71 | n/a | n/a | n/a | n/a | n/a | n/a | n/a | n/a |
Abbott Laboratories Curated by ChEMBL | Assay Description Inhibition of recombinant PDK1 after 1 hr by scintillation counter analysis in presence of gamma-[33P]ATP | Bioorg Med Chem Lett 22: 7615-22 (2012) Article DOI: 10.1016/j.bmcl.2012.10.009 BindingDB Entry DOI: 10.7270/Q2XK8GQ3 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
3-phosphoinositide-dependent protein kinase 1 (Homo sapiens (Human)) | BDBM50361646 (CHEMBL1940243) | PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | CHEMBL PC cid PC sid UniChem Similars | Article PubMed | 100 | n/a | n/a | n/a | n/a | n/a | n/a | n/a | n/a |
Pfizer Inc. Curated by ChEMBL | Assay Description Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISA | J Med Chem 54: 8490-500 (2011) Article DOI: 10.1021/jm201019k BindingDB Entry DOI: 10.7270/Q23N23TV | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
3-phosphoinositide-dependent protein kinase 1 (Homo sapiens (Human)) | BDBM50341250 (CHEMBL1765751 | N-{(3R,5R)-1-[2-Amino-6-(3-amino-1...) | PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | CHEMBL PC cid PC sid UniChem Patents Similars | Article PubMed | n/a | n/a | 0.631 | n/a | n/a | n/a | n/a | n/a | n/a |
GlaxoSmithKline Curated by ChEMBL | Assay Description Inhibition of PDK1 | J Med Chem 54: 1871-95 (2011) Article DOI: 10.1021/jm101527u BindingDB Entry DOI: 10.7270/Q2HQ406Q | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
3-phosphoinositide-dependent protein kinase 1 (Homo sapiens (Human)) | BDBM50341249 (1,1-Dimethylethyl{(3R,5R)-1-[2-Amino-6-(3-amino-1H...) | PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | CHEMBL PC cid PC sid UniChem Similars | Article PubMed | n/a | n/a | 0.794 | n/a | n/a | n/a | n/a | n/a | n/a |
GlaxoSmithKline Curated by ChEMBL | Assay Description Inhibition of PDK1 | J Med Chem 54: 1871-95 (2011) Article DOI: 10.1021/jm101527u BindingDB Entry DOI: 10.7270/Q2HQ406Q | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
3-phosphoinositide-dependent protein kinase 1 (Homo sapiens (Human)) | BDBM105303 (US8575203, I-70) | PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem Similars | US Patent | n/a | n/a | 1 | n/a | n/a | n/a | n/a | n/a | n/a |
Boehringer Ingelheim International GmbH US Patent | Assay Description The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit... | US Patent US8575203 (2013) BindingDB Entry DOI: 10.7270/Q2HD7T91 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
3-phosphoinositide-dependent protein kinase 1 (Homo sapiens (Human)) | BDBM105308 (US8575203, I-75) | PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem Similars | US Patent | n/a | n/a | 1 | n/a | n/a | n/a | n/a | n/a | n/a |
Boehringer Ingelheim International GmbH US Patent | Assay Description The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit... | US Patent US8575203 (2013) BindingDB Entry DOI: 10.7270/Q2HD7T91 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
3-phosphoinositide-dependent protein kinase 1 (Homo sapiens (Human)) | BDBM139845 (US8895581, III-31) | PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem Similars | US Patent | n/a | n/a | 1 | n/a | n/a | n/a | n/a | 7.5 | n/a |
Boehringer Ingelheim International GmbH US Patent | Assay Description Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma... | US Patent US8895581 (2014) BindingDB Entry DOI: 10.7270/Q2HM5742 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
3-phosphoinositide-dependent protein kinase 1 (Homo sapiens (Human)) | BDBM139765 (US8895581, I-1) | PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem Similars | US Patent | n/a | n/a | 1 | n/a | n/a | n/a | n/a | 7.5 | n/a |
Boehringer Ingelheim International GmbH US Patent | Assay Description Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma... | US Patent US8895581 (2014) BindingDB Entry DOI: 10.7270/Q2HM5742 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
3-phosphoinositide-dependent protein kinase 1 (Homo sapiens (Human)) | BDBM105283 (US8575203, I-50) | PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem Similars | US Patent | n/a | n/a | 1 | n/a | n/a | n/a | n/a | n/a | n/a |
Boehringer Ingelheim International GmbH US Patent | Assay Description The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit... | US Patent US8575203 (2013) BindingDB Entry DOI: 10.7270/Q2HD7T91 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
3-phosphoinositide-dependent protein kinase 1 (Homo sapiens (Human)) | BDBM139785 (US8895581, II-6) | PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem Similars | US Patent | n/a | n/a | 1 | n/a | n/a | n/a | n/a | 7.5 | n/a |
Boehringer Ingelheim International GmbH US Patent | Assay Description Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma... | US Patent US8895581 (2014) BindingDB Entry DOI: 10.7270/Q2HM5742 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
3-phosphoinositide-dependent protein kinase 1 (Homo sapiens (Human)) | BDBM139840 (US8895581, III-26) | PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem Similars | US Patent | n/a | n/a | 1 | n/a | n/a | n/a | n/a | 7.5 | n/a |
Boehringer Ingelheim International GmbH US Patent | Assay Description Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma... | US Patent US8895581 (2014) BindingDB Entry DOI: 10.7270/Q2HM5742 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
3-phosphoinositide-dependent protein kinase 1 (Homo sapiens (Human)) | BDBM139796 (US8895581, II-17) | PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem Similars | US Patent | n/a | n/a | 1 | n/a | n/a | n/a | n/a | 7.5 | n/a |
Boehringer Ingelheim International GmbH US Patent | Assay Description Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma... | US Patent US8895581 (2014) BindingDB Entry DOI: 10.7270/Q2HM5742 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
3-phosphoinositide-dependent protein kinase 1 (Homo sapiens (Human)) | BDBM139798 (US8895581, II-19) | PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem Similars | US Patent | n/a | n/a | 1 | n/a | n/a | n/a | n/a | 7.5 | n/a |
Boehringer Ingelheim International GmbH US Patent | Assay Description Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma... | US Patent US8895581 (2014) BindingDB Entry DOI: 10.7270/Q2HM5742 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
3-phosphoinositide-dependent protein kinase 1 (Homo sapiens (Human)) | BDBM139819 (US8895581, III-5) | PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem Similars | US Patent | n/a | n/a | 1 | n/a | n/a | n/a | n/a | 7.5 | n/a |
Boehringer Ingelheim International GmbH US Patent | Assay Description Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma... | US Patent US8895581 (2014) BindingDB Entry DOI: 10.7270/Q2HM5742 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
3-phosphoinositide-dependent protein kinase 1 (Homo sapiens (Human)) | BDBM139828 (US8895581, III-14) | PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem Similars | US Patent | n/a | n/a | 1 | n/a | n/a | n/a | n/a | 7.5 | n/a |
Boehringer Ingelheim International GmbH US Patent | Assay Description Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma... | US Patent US8895581 (2014) BindingDB Entry DOI: 10.7270/Q2HM5742 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
3-phosphoinositide-dependent protein kinase 1 (Homo sapiens (Human)) | BDBM139837 (US8895581, III-23) | PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem Similars | US Patent | n/a | n/a | 1 | n/a | n/a | n/a | n/a | 7.5 | n/a |
Boehringer Ingelheim International GmbH US Patent | Assay Description Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma... | US Patent US8895581 (2014) BindingDB Entry DOI: 10.7270/Q2HM5742 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
3-phosphoinositide-dependent protein kinase 1 (Homo sapiens (Human)) | BDBM50341241 ((3S,6R)-1-[6-(3-Amino-1H-indazol-6-yl)-2-(methylam...) | PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | CHEMBL PC cid PC sid UniChem Patents Similars | Article PubMed | n/a | n/a | 1.60 | n/a | n/a | n/a | n/a | n/a | n/a |
GlaxoSmithKline Curated by ChEMBL | Assay Description Inhibition of PDK1 | J Med Chem 54: 1871-95 (2011) Article DOI: 10.1021/jm101527u BindingDB Entry DOI: 10.7270/Q2HQ406Q | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
3-phosphoinositide-dependent protein kinase 1 (Homo sapiens (Human)) | BDBM105294 (US8575203, I-61) | PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem Similars | US Patent | n/a | n/a | 2 | n/a | n/a | n/a | n/a | n/a | n/a |
Boehringer Ingelheim International GmbH US Patent | Assay Description The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit... | US Patent US8575203 (2013) BindingDB Entry DOI: 10.7270/Q2HD7T91 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
3-phosphoinositide-dependent protein kinase 1 (Homo sapiens (Human)) | BDBM139842 (US8895581, III-28) | PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem Similars | US Patent | n/a | n/a | 2 | n/a | n/a | n/a | n/a | 7.5 | n/a |
Boehringer Ingelheim International GmbH US Patent | Assay Description Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma... | US Patent US8895581 (2014) BindingDB Entry DOI: 10.7270/Q2HM5742 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
3-phosphoinositide-dependent protein kinase 1 (Homo sapiens (Human)) | BDBM105305 (US8575203, I-72) | PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem Similars | US Patent | n/a | n/a | 2 | n/a | n/a | n/a | n/a | n/a | n/a |
Boehringer Ingelheim International GmbH US Patent | Assay Description The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit... | US Patent US8575203 (2013) BindingDB Entry DOI: 10.7270/Q2HD7T91 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
3-phosphoinositide-dependent protein kinase 1 (Homo sapiens (Human)) | BDBM139846 (US8895581, III-32) | PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem Similars | US Patent | n/a | n/a | 2 | n/a | n/a | n/a | n/a | 7.5 | n/a |
Boehringer Ingelheim International GmbH US Patent | Assay Description Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma... | US Patent US8895581 (2014) BindingDB Entry DOI: 10.7270/Q2HM5742 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
3-phosphoinositide-dependent protein kinase 1 (Homo sapiens (Human)) | BDBM139847 (US8895581, III-33) | PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem Similars | US Patent | n/a | n/a | 2 | n/a | n/a | n/a | n/a | 7.5 | n/a |
Boehringer Ingelheim International GmbH US Patent | Assay Description Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma... | US Patent US8895581 (2014) BindingDB Entry DOI: 10.7270/Q2HM5742 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
3-phosphoinositide-dependent protein kinase 1 (Homo sapiens (Human)) | BDBM139768 (US8895581, I-4) | PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem Similars | US Patent | n/a | n/a | 2 | n/a | n/a | n/a | n/a | 7.5 | n/a |
Boehringer Ingelheim International GmbH US Patent | Assay Description Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma... | US Patent US8895581 (2014) BindingDB Entry DOI: 10.7270/Q2HM5742 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
3-phosphoinositide-dependent protein kinase 1 (Homo sapiens (Human)) | BDBM139774 (US8895581, I-10) | PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem Similars | US Patent | n/a | n/a | 2 | n/a | n/a | n/a | n/a | 7.5 | n/a |
Boehringer Ingelheim International GmbH US Patent | Assay Description Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma... | US Patent US8895581 (2014) BindingDB Entry DOI: 10.7270/Q2HM5742 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
3-phosphoinositide-dependent protein kinase 1 (Homo sapiens (Human)) | BDBM139780 (US8895581, II-1) | PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem Similars | US Patent | n/a | n/a | 2 | n/a | n/a | n/a | n/a | 7.5 | n/a |
Boehringer Ingelheim International GmbH US Patent | Assay Description Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma... | US Patent US8895581 (2014) BindingDB Entry DOI: 10.7270/Q2HM5742 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
3-phosphoinositide-dependent protein kinase 1 (Homo sapiens (Human)) | BDBM105309 (US8575203, I-76) | PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem Similars | US Patent | n/a | n/a | 2 | n/a | n/a | n/a | n/a | n/a | n/a |
Boehringer Ingelheim International GmbH US Patent | Assay Description The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit... | US Patent US8575203 (2013) BindingDB Entry DOI: 10.7270/Q2HD7T91 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
3-phosphoinositide-dependent protein kinase 1 (Homo sapiens (Human)) | BDBM105356 (US8575203, I-123) | PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem Similars | US Patent | n/a | n/a | 2 | n/a | n/a | n/a | n/a | n/a | n/a |
Boehringer Ingelheim International GmbH US Patent | Assay Description The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit... | US Patent US8575203 (2013) BindingDB Entry DOI: 10.7270/Q2HD7T91 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
3-phosphoinositide-dependent protein kinase 1 (Homo sapiens (Human)) | BDBM105357 (US8575203, I-124) | PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem Similars | US Patent | n/a | n/a | 2 | n/a | n/a | n/a | n/a | n/a | n/a |
Boehringer Ingelheim International GmbH US Patent | Assay Description The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit... | US Patent US8575203 (2013) BindingDB Entry DOI: 10.7270/Q2HD7T91 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
3-phosphoinositide-dependent protein kinase 1 (Homo sapiens (Human)) | BDBM105358 (US8575203, I-125) | PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem Similars | US Patent | n/a | n/a | 2 | n/a | n/a | n/a | n/a | n/a | n/a |
Boehringer Ingelheim International GmbH US Patent | Assay Description The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit... | US Patent US8575203 (2013) BindingDB Entry DOI: 10.7270/Q2HD7T91 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
3-phosphoinositide-dependent protein kinase 1 (Homo sapiens (Human)) | BDBM105367 (US8575203, I-125.9) | PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem Similars | US Patent | n/a | n/a | 2 | n/a | n/a | n/a | n/a | n/a | n/a |
Boehringer Ingelheim International GmbH US Patent | Assay Description The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit... | US Patent US8575203 (2013) BindingDB Entry DOI: 10.7270/Q2HD7T91 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
3-phosphoinositide-dependent protein kinase 1 (Homo sapiens (Human)) | BDBM105375 (US8575203, I-125.17) | PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem Similars | US Patent | n/a | n/a | 2 | n/a | n/a | n/a | n/a | n/a | n/a |
Boehringer Ingelheim International GmbH US Patent | Assay Description The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit... | US Patent US8575203 (2013) BindingDB Entry DOI: 10.7270/Q2HD7T91 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
3-phosphoinositide-dependent protein kinase 1 (Homo sapiens (Human)) | BDBM105376 (US8575203, I-125.18) | PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem Similars | US Patent | n/a | n/a | 2 | n/a | n/a | n/a | n/a | n/a | n/a |
Boehringer Ingelheim International GmbH US Patent | Assay Description The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit... | US Patent US8575203 (2013) BindingDB Entry DOI: 10.7270/Q2HD7T91 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
3-phosphoinositide-dependent protein kinase 1 (Homo sapiens (Human)) | BDBM105379 (US8575203, I-125.21) | PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem Similars | US Patent | n/a | n/a | 2 | n/a | n/a | n/a | n/a | n/a | n/a |
Boehringer Ingelheim International GmbH US Patent | Assay Description The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit... | US Patent US8575203 (2013) BindingDB Entry DOI: 10.7270/Q2HD7T91 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
3-phosphoinositide-dependent protein kinase 1 (Homo sapiens (Human)) | BDBM105263 (US8575203, I-30) | PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem Similars | US Patent | n/a | n/a | 2 | n/a | n/a | n/a | n/a | n/a | n/a |
Boehringer Ingelheim International GmbH US Patent | Assay Description The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit... | US Patent US8575203 (2013) BindingDB Entry DOI: 10.7270/Q2HD7T91 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
3-phosphoinositide-dependent protein kinase 1 (Homo sapiens (Human)) | BDBM105273 (US8575203, I-40) | PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem Similars | US Patent | n/a | n/a | 2 | n/a | n/a | n/a | n/a | n/a | n/a |
Boehringer Ingelheim International GmbH US Patent | Assay Description The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit... | US Patent US8575203 (2013) BindingDB Entry DOI: 10.7270/Q2HD7T91 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
3-phosphoinositide-dependent protein kinase 1 (Homo sapiens (Human)) | BDBM105284 (US8575203, I-51) | PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem Similars | US Patent | n/a | n/a | 2 | n/a | n/a | n/a | n/a | n/a | n/a |
Boehringer Ingelheim International GmbH US Patent | Assay Description The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit... | US Patent US8575203 (2013) BindingDB Entry DOI: 10.7270/Q2HD7T91 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
3-phosphoinositide-dependent protein kinase 1 (Homo sapiens (Human)) | BDBM105295 (US8575203, I-62) | PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem Similars | US Patent | n/a | n/a | 2 | n/a | n/a | n/a | n/a | n/a | n/a |
Boehringer Ingelheim International GmbH US Patent | Assay Description The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit... | US Patent US8575203 (2013) BindingDB Entry DOI: 10.7270/Q2HD7T91 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
3-phosphoinositide-dependent protein kinase 1 (Homo sapiens (Human)) | BDBM139820 (US8895581, III-6) | PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem Similars | US Patent | n/a | n/a | 2 | n/a | n/a | n/a | n/a | 7.5 | n/a |
Boehringer Ingelheim International GmbH US Patent | Assay Description Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma... | US Patent US8895581 (2014) BindingDB Entry DOI: 10.7270/Q2HM5742 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
3-phosphoinositide-dependent protein kinase 1 (Homo sapiens (Human)) | BDBM139816 (US8895581, III-2) | PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem Similars | US Patent | n/a | n/a | 2 | n/a | n/a | n/a | n/a | 7.5 | n/a |
Boehringer Ingelheim International GmbH US Patent | Assay Description Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma... | US Patent US8895581 (2014) BindingDB Entry DOI: 10.7270/Q2HM5742 | |||||||||||
More data for this Ligand-Target Pair |
Displayed 1 to 50 (of 1264 total ) | Next | Last >> |