BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:BDBM2683
Syringe Reactant:Serine/threonine-protein kinase PIM
Meas. Tech.:Isothermal Titration Calorimetry
Entry Date:10/29/06
 
ΔG°:-10.4± (kcal/mole)
pH:7.5±n/a
Log10Kb:7.99± 7.34
Temperature:283.15±n/a (K)
ΔH° :n/a
ΔHobs :-14.3±0.100 (kcal/mole)
Ionic Strength:n/a
Corrected for ΔHioniz:no
Protons Released:n/a
ΔCp :n/a
Stoich. Param.:0.64
ΔS° :-0.0100± (kcal/mole-K)
Comments:n/a
 
Citation Bullock ANDebreczeni JEFedorov OYNelson AMarsden BDKnapp S Structural basis of inhibitor specificity of the human protooncogene proviral insertion site in moloney murine leukemia virus (PIM-1) kinase. J Med Chem 48:7604-14 (2005) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data ,  Solution Info ,  Data Fit Method ,  Instrument Info
 
BDBM2683
Source:LC Laboratories
Purity:n/a
Prep. Method:n/a
Name:Serine/threonine-protein kinase PIM
Synonyms:2.7.11.1 | PIM-1 Kinase | PIM1 | Proto-oncogene serine/threonine-protein kinase Pim-1 | Serine/threonine-protein kinase (PIM1) | Serine/threonine-protein kinase PIM1 | Serine/threonine-protein kinase pim-1 | Serine/threonine-protein kinase pim-1 (PIM1)
Type:Protein
Mol. Mass.:45417.87
Organism:Homo sapiens (Human)
Description:P11309
Residue:313
Sequence:
MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSD
NLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLIL
ERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRG
ELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI
PFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETA
EIHLHSLSPGPSK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Serine/threonine-protein kinase PIM
Source:Full-length human PIM-1 was subcloned and expressed in E. coli cells.
Purity:n/a
Prep. Method:Cells were lysed, and the lysate was purified by Ni-NTA chromatography. The protein was further purified on a monoQ column and resolved into two species, shown by ESI-MS to be homogeneous nonphosphorylated and singularly phosphorylated PIM-1.
Name:Serine/threonine-protein kinase PIM1
Synonyms:n/a
Type:Enzyme
Mol. Mass.:45417.87
Organism:Homo sapiens (Human)
Description:n/a
Residue:404
Sequence:
MPHEPHEPLTPPFSALPDPAGAPSRRQSRQRPQLSSDSPSAFRASRSHSRNATRSHSHSH
SPRHSLRHSPGSGSCGSSSGHRPCADILEVGMLLSKINSLAHLRAAPCNDLHATKLAPGK
EKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGELPNGTRVPME
VVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFW
QVLEAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSP
PEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIRGQVFFRQRVSSECQHLIRW
CLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPSK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.