BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:HIV-1 Nef
Syringe Reactant:BDBM22594
Meas. Tech.:Isothermal Titration Calorimetry
Entry Date:06/14/08
 
ΔG°:-28± (kJ/mole)
pH:7±n/a
Log10Kb:4.96± 4.65
Temperature:298.15±n/a (K)
ΔH° :n/a
ΔHobs :-1.80±0.330 (kJ/mole)
Ionic Strength:n/a
Corrected for ΔHioniz:no
Protons Released:n/a
ΔCp :n/a
Stoich. Param.:1
ΔS° : 0.0879± (kJ/mole-K)
Comments:n/a
 
Citation Betzi, SRestouin, AOpi, SArold, STParrot, IGuerlesquin, FMorelli, XCollette, Y Protein protein interaction inhibition (2P2I) combining high throughput and virtual screening: Application to the HIV-1 Nef protein. Proc Natl Acad Sci USA104:19256-61 (2007) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data ,  Solution Info ,  Data Fit Method ,  Instrument Info
 
HIV-1 Nef
Source:The HIV-1 Nef core domain (residues 57-205) was expressed in Escherichia coli as glutathione S-transferase fusion proteins.
Purity:n/a
Prep. Method:n/a
Name:HIV-1 Nef
Synonyms:3ORF | F-protein | Nef | Negative factor | Protein Nef
Type:C-terminal core protein
Mol. Mass.:23340.47
Organism:Human immunodeficiency virus type 1 (isolate BRU/LAI group M subtype B)
Description:P03406
Residue:206
Sequence:
MGGKWSKSSVVGWPTVRERMRRAEPAADGVGAASRDLEKHGAITSSNTAATNAACAWLEA
QEEEEVGFPVTPQVPLRPMTYKAAVDLSHFLKEKGGLEGLIHSQRRQDILDLWIYHTQGY
FPDWQNYTPGPGVRYPLTFGWCYKLVPVEPDKVEEANKGENTSLLHPVSLHGMDDPEREV
LEWRFDSRLAFHHVARELHPEYFKNC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22594
Source:n/a
Purity:n/a
Prep. Method:n/a
NameBDBM22594
Synonyms:7-methoxy-4-nitro-5-oxatricyclo[7.4.0.0^{2,6}]trideca-1(13),2(6),3,7,9,11-hexaene | Compound D15
TypeSmall organic molecule
Emp. Form.C13H9NO4
Mol. Mass.243.2149
SMILESCOc1cc2ccccc2c2cc(oc12)[N+]([O-])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.