new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:Major Urinary Protein (MUP-1)
Syringe Reactant:BDBM22607
Meas. Tech.:Isothermal Titration Calorimetry
Entry Date:06/15/08
 
ΔG°:-38.8±0.200 (kJ/mole)
pH:7.4±n/a
Log10Kb:6.74± 6.09
Temperature:300±n/a (K)
ΔH° :n/a
ΔHobs :-63.6±0.400 (kJ/mole)
Ionic Strength:n/a
Corrected for ΔHioniz:no
Protons Released:n/a
ΔCp :n/a
Stoich. Param.:0.98
ΔS° : -0.0827±0.00170 (kJ/mole-K)
Comments:Kd value was obtained from J. Mol. Biol. (2006) 362,994-1003.
 
Citation Malham RJohnstone SBingham RJBarratt EPhillips SELaughton CAHomans SW Strong solute-solute dispersive interactions in a protein-ligand complex. J Am Chem Soc 127:17061-7 (2005) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data ,  Solution Info ,  Data Fit Method ,  Instrument Info
 
Major Urinary Protein (MUP-1)
Source:The MUP-1 gene was cloned and expressed in E. coli cells.
Purity:n/a
Prep. Method:MUP-I was purified using Ni-NTA resin. To remove endogenous bound ligands, an ethanol precipitation step was utilized involving addition of 2 volumes of absolute ethanol per volume of protein solution, followed by incubation at 4 C for 2 h. After centrifugation at 5000g, the pellet was lyophilised, resuspended in PBS pH 7.4, and dialyzed overnight against the same buffer.
Name:Major Urinary Protein (MUP-1)
Synonyms:Major urinary protein 1 precursor
Type:Other Protein Type
Mol. Mass.:20640.17
Organism:Mus musculus (mouse)
Description:n/a
Residue:180
Sequence:
MKMLLLLCLGLTLVCVHAEEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFL
EQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLM
AHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEKHGILRENIIDLSNANRCLQARE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22607
Source:n/a
Purity:n/a
Prep. Method:n/a
NameBDBM22607
Synonyms:1-Nonanol | Nonan-1-ol
TypeSmall organic molecule
Emp. Form.C9H20O
Mol. Mass.144.2545
SMILESCCCCCCCCCO
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.