new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:Quinone Reductase 2 (QR2)
Syringe Reactant:BDBM9019
Meas. Tech.:Isothermal Titration Calorimetry
Entry Date:06/10/09
 
ΔG°:-8.07±0.300 (kcal/mole)
pH:7.5±n/a
Log10Kb:5.85± 5.22
Temperature:298.15±n/a (K)
ΔH° :n/a
ΔHobs :-10.4±0.400 (kcal/mole)
Ionic Strength:n/a
Corrected for ΔHioniz:no
Protons Released:n/a
ΔCp :n/a
Stoich. Param.:0.8
ΔS° :-0.0100±0 (kcal/mole-K)
Comments:n/a
 
Citation Calamini BSantarsiero BDBoutin JAMesecar AD Kinetic, thermodynamic and X-ray structural insights into the interaction of melatonin and analogues with quinone reductase 2. Biochem J 413:81-91 (2008) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data ,  Solution Info ,  Data Fit Method ,  Instrument Info
 
Quinone Reductase 2 (QR2)
Source:Human QR2 was expressed and purified from E. coli cells.
Purity:n/a
Prep. Method:The enzyme was further applied to a Hiload 26/60 Superdex 75 (GE Healthcare) column. The fractions containing pure enzyme were pooled and finally applied to a 10/100 GL MonoQ (GE Healthcare) strong anion-exchange column. The protein was eluted using a gradient. The purest protein fractions were pooled, buffer-exchanged and concentrated. Samples of QR2 were extensively dialysed against ITC buffer, and degassed before assay.
Name:Ribosyldihydronicotinamide dehydrogenase [quinone]
Synonyms:Metallothionein-3 | NRH dehydrogenase [quinone] 2 | NRH:quinone oxidoreductase 2 | QR2 | Quinone reductase 2 | Quinone reductase 2 (NQO2) | Ribosyldihydronicotinamide dehydrogenase [quinone]
Type:Protein
Mol. Mass.:25917.25
Organism:Homo sapiens (Human)
Description:P16083
Residue:231
Sequence:
MAGKKVLIVYAHQEPKSFNGSLKNVAVDELSRQGCTVTVSDLYAMNLEPRATDKDITGTL
SNPEVFNYGVETHEAYKQRSLASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRV
LCQGFAFDIPGFYDSGLLQGKLALLSVTTGGTAEMYTKTGVNGDSRYFLWPLQHGTLHFC
GFKVLAPQISFAPEIASEEERKGMVAAWSQRLQTIWKEEPIPCTAHWHFGQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM9019
Source:n/a
Purity:n/a
Prep. Method:n/a
NameBDBM9019
Synonyms:CHEMBL45 | Melatonin | N-[2-(5-methoxy-1H-indol-3-yl)ethyl]acetamide
TypeSmall organic molecule
Emp. Form.C13H16N2O2
Mol. Mass.232.2783
SMILESCOc1ccc2[nH]cc(CCNC(C)=O)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.