new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:HIV-1 Protease Mutant (V82A/I84V)
Syringe Reactant:BDBM520
Meas. Tech.:Isothermal Titration Calorimetry
Entry Date:05/10/04
 
ΔG°:-49.7± (kJ/mole)
pH:5±n/a
Log10Kb:8.70± 7.60
Temperature:298.15±n/a (K)
ΔH° :-15.0±0.836 (kJ/mole)
ΔHobs :-15.0±0.836 (kJ/mole)
Ionic Strength:n/a
Corrected for ΔHioniz:not known
Protons Released:n/a
ΔCp :n/a
Stoich. Param.:n/a
ΔS° : 0.1164± (kJ/mole-K)
Comments:The binding affinities were determined by using ITC displacement experiments. Acetyl pepstatin was selected as the weak inhibitor in the displacement titration because this inhibitor is endothermic and amplifies the signal of a high affinity exothermic inhibitor when displaced
 
Citation Ohtaka HSchön AFreire E Multidrug resistance to HIV-1 protease inhibition requires cooperative coupling between distal mutations. Biochemistry 42:13659-66 (2003) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data ,  Solution Info ,  Data Fit Method ,  Instrument Info
 
HIV-1 Protease Mutant (V82A/I84V)
Source:Plasmid-encoded HIV-1 protease was expressed in E. coli cells.
Purity:99%
Prep. Method:HIV-1 protease was purified and refolded from E. coli inclusion bodies.
Name:HIV-1 Protease Mutant (V82A/I84V)
Synonyms:n/a
Type:Protein Complex
Mol. Mass.:n/a
Description:n/a
Components:This complex has 2 components.
Component 1
Name:HIV-1 Protease Mutant (V82A/I84V) chain A
Synonyms:HIV-1 Protease Mutant (Q7K/L33I/L63I/V82A/I84V) | HIV-1 Protease Mutant (V82A/I84V) chain B
Type:Enzyme Subunit
Mol. Mass.:10754.16
Organism:Human immunodeficiency virus type 1
Description:Mutations at selected positions (V82A/I84V) were introduced into HIV-1 protease pseudo wild type (Q7K/L33I/L63I)
Residue:99
Sequence:
PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYD
QIIIEICGHKAIGTVLVGPTPANVIGRNLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:HIV-1 Protease Mutant (V82A/I84V) chain A
Synonyms:HIV-1 Protease Mutant (Q7K/L33I/L63I/V82A/I84V) | HIV-1 Protease Mutant (V82A/I84V) chain B
Type:Enzyme Subunit
Mol. Mass.:10754.16
Organism:Human immunodeficiency virus type 1
Description:Mutations at selected positions (V82A/I84V) were introduced into HIV-1 protease pseudo wild type (Q7K/L33I/L63I)
Residue:99
Sequence:
PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYD
QIIIEICGHKAIGTVLVGPTPANVIGRNLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM520
Source:Purified from commercial capsules
Purity:n/a
Prep. Method:Further purified by HPLC using a semipreparative C-18 reversed-phase column developed with 0-100% acetonitrile in 0.05% TFA
NameBDBM520
Synonyms:1,3-thiazol-5-ylmethyl N-[(2S,3S,5S)-3-hydroxy-5-[(2S)-3-methyl-2-{[methyl({[2-(propan-2-yl)-1,3-thiazol-4-yl]methyl})carbamoyl]amino}butanamido]-1,6-diphenylhexan-2-yl]carbamate | ABT-538 | CHEMBL163 | Norvir | RTV | Ritonavir
TypeSmall organic molecule
Emp. Form.n/a
Mol. Mass.n/a
SMILESn/a
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.