new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:HIV-1 Protease A Subtype
Syringe Reactant:BDBM520
Meas. Tech.:Isothermal Titration Calorimetry
Entry Date:06/22/04
 
ΔG°:-13.2± (kcal/mole)
pH:5±n/a
Log10Kb:9.65± 8
Temperature:298.15±n/a (K)
ΔH° :-2.90± (kcal/mole)
ΔHobs :-2.90± (kcal/mole)
Ionic Strength:n/a
Corrected for ΔHioniz:not known
Protons Released:n/a
ΔCp :n/a
Stoich. Param.:n/a
ΔS° :0.0300± (kcal/mole-K)
Comments:In displacement titration, inhibitors were injected into the calorimetric cell containing the protein prebound to a weak inhibitor acetylpepstatin.
 
Citation Velazquez-Campoy AVega SFreire E Amplification of the effects of drug resistance mutations by background polymorphisms in HIV-1 protease from African subtypes. Biochemistry 41:8613-9 (2002) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data ,  Solution Info ,  Instrument Info
 
HIV-1 Protease A Subtype
Source:Plasmid-encoded HIV-1 protease was expressed in E. coli cells.
Purity:99%
Prep. Method:HIV-1 protease was purified and refolded from E. coli inclusion bodies.
Name:HIV-1 Protease A Subtype
Synonyms:n/a
Type:Protein Complex
Mol. Mass.:n/a
Description:n/a
Components:This complex has 2 components.
Component 1
Name:HIV-1 Protease A Subtype chain A
Synonyms:HIV-1 Protease A Subtype chain B | HIV-1 Protease Mutant (Q7K/I13V/E35D/M36I/S37N/R41K/R57K/H69K/L89M)
Type:Enzyme Subunit
Mol. Mass.:10716.69
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQVTLWKRPLVTVKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:HIV-1 Protease A Subtype chain A
Synonyms:HIV-1 Protease A Subtype chain B | HIV-1 Protease Mutant (Q7K/I13V/E35D/M36I/S37N/R41K/R57K/H69K/L89M)
Type:Enzyme Subunit
Mol. Mass.:10716.69
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQVTLWKRPLVTVKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM520
Source:Purified from commercial capsules
Purity:n/a
Prep. Method:Further purified by HPLC using a semipreparative C-18 reversed-phase column developed with 0-100% acetonitrile in 0.05% TFA
NameBDBM520
Synonyms:1,3-thiazol-5-ylmethyl N-[(2S,3S,5S)-3-hydroxy-5-[(2S)-3-methyl-2-{[methyl({[2-(propan-2-yl)-1,3-thiazol-4-yl]methyl})carbamoyl]amino}butanamido]-1,6-diphenylhexan-2-yl]carbamate | ABT-538 | CHEMBL163 | Norvir | RTV | Ritonavir
TypeSmall organic molecule
Emp. Form.n/a
Mol. Mass.n/a
SMILESn/a
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.