BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:HIV-1 Protease Mutant, NAM-10
Syringe Reactant:BDBM519
Meas. Tech.:Isothermal Titration Calorimetry
Entry Date:06/23/04
 
ΔG°:-36.4± (kJ/mole)
pH:5±n/a
Log10Kb:6.38± 5.44
Temperature:298.15±n/a (K)
ΔH° :26.8± (kJ/mole)
ΔHobs :26.8± (kJ/mole)
Ionic Strength:n/a
Corrected for ΔHioniz:not known
Protons Released:n/a
ΔCp :n/a
Stoich. Param.:n/a
ΔS° : 0.2118± (kJ/mole-K)
Comments:In displacement titration experiments, inhibitors were injected into the calorimetric cell containing the protein prebound to a weak inhibitor, acetylpepstatin
 
Citation Muzammil SMuzammil SRoss PRoss PFreire EFreire E A major role for a set of non-active site mutations in the development of HIV-1 protease drug resistance. Biochemistry 42:631-8 (2003) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data ,  Solution Info ,  Data Fit Method ,  Instrument Info
 
HIV-1 Protease Mutant, NAM-10
Source:Plasmid-encoded HIV-1 protease was expressed in E. coli cells.
Purity:99%
Prep. Method:HIV-1 protease was purified and refolded from E. coli inclusion bodies.
Name:HIV-1 Protease Mutant, NAM-10
Synonyms:n/a
Type:Protein Complex
Mol. Mass.:n/a
Description:n/a
Components:This complex has 2 components.
Component 1
Name:HIV-1 Protease Mutant, NAM-10 chain A
Synonyms:HIV-1 Protease Mutant (Q7K/L10I/M36I/S37D/M46I/R57K/L63P/A71V/G73S/L90M/I93L) | HIV-1 Protease Mutant, NAM-10 chain B
Type:Enzyme Subunit
Mol. Mass.:10805.20
Organism:Human immunodeficiency virus type 1
Description:All of the protease constructs in this study are on the wild type containing the single Q7K mutation to prevent autocatalysis.This protein has enzymatic properties similar to that of the wild type protease.
Residue:99
Sequence:
PQVTLWKRPIVTIKIGGQLKEALLDTGADDTVLEEIDLPGRWKPKIIGGIGGFIKVKQYD
QIPIEICGHKVISTVLVGPTPVNIIGRNLMTQLGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:HIV-1 Protease Mutant, NAM-10 chain A
Synonyms:HIV-1 Protease Mutant (Q7K/L10I/M36I/S37D/M46I/R57K/L63P/A71V/G73S/L90M/I93L) | HIV-1 Protease Mutant, NAM-10 chain B
Type:Enzyme Subunit
Mol. Mass.:10805.20
Organism:Human immunodeficiency virus type 1
Description:All of the protease constructs in this study are on the wild type containing the single Q7K mutation to prevent autocatalysis.This protein has enzymatic properties similar to that of the wild type protease.
Residue:99
Sequence:
PQVTLWKRPIVTIKIGGQLKEALLDTGADDTVLEEIDLPGRWKPKIIGGIGGFIKVKQYD
QIPIEICGHKVISTVLVGPTPVNIIGRNLMTQLGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM519
Source:Purified from commercial capsules
Purity:n/a
Prep. Method:Further purified by HPLC using a semipreparative C-18 reversed-phase column developed with 0-100% acetonitrile in 0.05% TFA
NameBDBM519
Synonyms:(2S)-N-[(2S,3R)-4-[(3S,4aS,8aS)-3-(tert-butylcarbamoyl)-decahydroisoquinolin-2-yl]-3-hydroxy-1-phenylbutan-2-yl]-2-(quinolin-2-ylformamido)butanediamide | CHEMBL114 | Fortovase | Invirase | Ro 31-8959 | SQV | Saquinavir
TypeSmall organic molecule
Emp. Form.n/a
Mol. Mass.n/a
SMILESn/a
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.