Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetcAMP-specific 3',5'-cyclic phosphodiesterase 4D
LigandBDBM285583
Substrate/Competitorn/a
IC50 3930±n/a nM
Citation Chappie TAVerhoest PRPatel NCHayward MMHelal CJSciabola SLaChapelle EAYoung JM Imidazopyridazine compounds US Patent  US9598421 Publication Date 3/21/2017
More Info.:Get all data from this article,  Assay Method
 
cAMP-specific 3',5'-cyclic phosphodiesterase 4D
Name:cAMP-specific 3',5'-cyclic phosphodiesterase 4D
Synonyms:DPDE3 | PDE43 | PDE4D | Phosphodiesterase 4D
Type:Protein
Mol. Mass.:91092.69
Organism:Homo sapiens (Human)
Description:Q08499
Residue:809
Sequence:
MEAEGSSAPARAGSGEGSDSAGGATLKAPKHLWRHEQHHQYPLRQPQFRLLHPHHHLPPP
PPPSPQPQPQCPLQPPPPPPLPPPPPPPGAARGRYASSGATGRVRHRGYSDTERYLYCRA
MDRTSYAVETGHRPGLKKSRMSWPSSFQGLRRFDVDNGTSAGRSPLDPMTSPGSGLILQA
NFVHSQRRESFLYRSDSDYDLSPKSMSRNSSIASDIHGDDLIVTPFAQVLASLRTVRNNF
AALTNLQDRAPSKRSPMCNQPSINKATITEEAYQKLASETLEELDWCLDQLETLQTRHSV
SEMASNKFKRMLNRELTHLSEMSRSGNQVSEFISNTFLDKQHEVEIPSPTQKEKEKKKRP
MSQISGVKKLMHSSSLTNSSIPRFGVKTEQEDVLAKELEDVNKWGLHVFRIAELSGNRPL
TVIMHTIFQERDLLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVVQSTHVLLST
PALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGF
KLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVL
LLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFRQGDRERERGMEISPMC
DKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQSTIPQSPSPAP
DDPEEGRQGQTEKFQFELTLEEDGESDTEKDSGSQVEEDTSCSDSKTLCTQDSESTEIPL
DEQVEEEAVGEEEESQPEACVIDDRSPDT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM285583
n/a
NameBDBM285583
Synonyms:US10077269, Example 56 | US9598421, Example 56 | azetidin-1-yl[3-(4-chloro-2-methylphenyl)imidazo[1,2-b]pyridazin-2-yl]methanone
TypeSmall organic molecule
Emp. Form.C17H15ClN4O
Mol. Mass.326.78
SMILESCc1cc(Cl)ccc1-c1c(nc2cccnn12)C(=O)N1CCC1 |(-2.46,1.44,;-.98,1.83,;-.58,3.32,;.91,3.72,;1.31,5.21,;2,2.63,;1.6,1.14,;.11,.75,;-.29,-.74,;.62,-1.99,;-.29,-3.23,;-1.75,-2.76,;-3.08,-3.53,;-4.42,-2.76,;-4.42,-1.22,;-3.08,-.45,;-1.75,-1.22,;2.16,-1.99,;2.93,-.65,;2.93,-3.32,;2.53,-4.81,;4.02,-5.21,;4.42,-3.72,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: