Reaction Details |
| Report a problem with these data |
Target | Isocitrate dehydrogenase [NADP] cytoplasmic [R132H] |
---|
Ligand | BDBM303127 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Mutant IDH1 Cellular Assay |
---|
IC50 | 22.0±n/a nM |
---|
Citation | Rehwinkel, H; Anlauf, S; Nguyen, D; Panknin, O; Bauser, M; Zimmermann, K; Kaulfuss, S; Neuhaus, R; Blaney, PM; Toschi, G 1-cyclohexyl-2-phenylaminobenzimidazoles as mIDH1 inhibitors for the treatment of tumors US Patent US10137110 Publication Date 11/27/2018 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Isocitrate dehydrogenase [NADP] cytoplasmic [R132H] |
---|
Name: | Isocitrate dehydrogenase [NADP] cytoplasmic [R132H] |
Synonyms: | Cytosolic NADP-isocitrate dehydrogenase (IDH1)(R132H) | IDH1 | IDH1 R132H | IDH1(R132H) | IDHC_HUMAN | Isocitrate dehydrogenase (IDH1)(R132H) | Isocitrate dehydrogenase 1 mutant (R132H) | Isocitrate dehydrogenase [NADP] cytoplasmic (IDH)(R132H) | Isocitrate dehydrogenase [NADP] cytoplasmic (IDH1)(R132H) | Isocitrate dehydrogenase [NADP] cytoplasmic (R132H) | PICD |
Type: | Protein |
Mol. Mass.: | 46641.74 |
Organism: | Homo sapiens (Human) |
Description: | Human IDH1 R132H (SEQ ID No. 2 in patent). First three are removed. Google patent parsed wrong. |
Residue: | 414 |
Sequence: | MSKKISGGSVVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDA
AEAIKKHNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRL
VSGWVKPIIIGHHAYGDQYRATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAM
GMYNQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKSQFE
AQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLVCPDG
KTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRGLAHRAKLDNNKELAFFANALE
EVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAKL
|
|
|
BDBM303127 |
---|
n/a |
---|
Name | BDBM303127 |
Synonyms: | 5-[6-methyl-1-(3,3,5,5-tetramethylcyclohexyl)-2-{[4-(trifluoromethoxy)phenyl]amino}-1H-benzimidazol-5-yl]-1,3-oxazolidine-2,4-dione | US10137110, Example 2-36 |
Type | Small organic molecule |
Emp. Form. | C28H31F3N4O4 |
Mol. Mass. | 544.5653 |
SMILES | Cc1cc2n(C3CC(C)(C)CC(C)(C)C3)c(Nc3ccc(OC(F)(F)F)cc3)nc2cc1C1OC(=O)NC1=O |
Structure |
|