Reaction Details |
| Report a problem with these data |
Target | Dimer of Gag-Pol polyprotein [501-599,Q508K,L534I,L564I,C568A,C596A,D531N] |
---|
Ligand | BDBM517 |
---|
Substrate/Competitor | HIV Peptide Substrate |
---|
Meas. Tech. | Protease Inhibition Assay |
---|
pH | 5.6±n/a |
---|
Temperature | 310.15±n/a K |
---|
Ki | 7.0±1.0 nM |
---|
Km | 31000±5000 nM |
---|
Comments | Kcat/Km=7±1 min-1nM-1 |
---|
Citation | Kovalevsky, AY; Tie, Y; Liu, F; Boross, PI; Wang, YF; Leshchenko, S; Ghosh, AK; Harrison, RW; Weber, IT Effectiveness of nonpeptide clinical inhibitor TMC-114 on HIV-1 protease with highly drug resistant mutations D30N, I50V, and L90M. J Med Chem49:1379-87 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
---|
|
Dimer of Gag-Pol polyprotein [501-599,Q508K,L534I,L564I,C568A,C596A,D531N] |
---|
Name: | Dimer of Gag-Pol polyprotein [501-599,Q508K,L534I,L564I,C568A,C596A,D531N] |
Synonyms: | HIV-1 Protease Mutant (D30N) |
Type: | Protein Complex |
Mol. Mass.: | n/a |
Description: | n/a |
Components: | This complex has 2 components. |
Component 1 |
Name: | Gag-Pol polyprotein [501-599,Q508K,L534I,L564I,C568A,C596A,D531N] |
Synonyms: | HIV-1 Protease Mutant (D30N) chain A | HIV-1 Protease Mutant (D30N) chain B | LAI(D30N) | POL_HV1BR | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10732.13 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P03367[501-599,Q508K,L534I,L564I,C568A,C596A,D531N] |
Residue: | 99 |
Sequence: | PQITLWKRPLVTIKIGGQLKEALLDTGADNTVIEEMSLPGRWKPKMIGGIGGFIKVRQYD
QIIIEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF
|
|
|
Component 2 |
Name: | Gag-Pol polyprotein [501-599,Q508K,L534I,L564I,C568A,C596A,D531N] |
Synonyms: | HIV-1 Protease Mutant (D30N) chain A | HIV-1 Protease Mutant (D30N) chain B | LAI(D30N) | POL_HV1BR | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10732.13 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P03367[501-599,Q508K,L534I,L564I,C568A,C596A,D531N] |
Residue: | 99 |
Sequence: | PQITLWKRPLVTIKIGGQLKEALLDTGADNTVIEEMSLPGRWKPKMIGGIGGFIKVRQYD
QIIIEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF
|
|
|
BDBM517 |
---|
HIV Peptide Substrate |
---|
Name: | HIV Peptide Substrate |
Synonyms: | n/a |
Type: | Peptide |
Mol. Mass.: | 3156.95 |
Organism: | n/a |
Description: | n/a |
Residue: | 27 |
Sequence: | Ac-RE(Edans)SQNY*PIVRK(Dabcyl)R-CO-NH2
|
|
|