BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetOxysterols receptor LXR-beta
LigandBDBM304402
Substrate/Competitorn/a
Meas. Tech.LXR alpha/beta Radioligand Binding Assay
Ki 5.00±n/a nM
Citation Claremon DADong CFan YLeftheris KLotesta SDSingh SBTice CMZhao WZheng YZhuang L Piperazine derivatives as liver X receptor modulators US Patent  US10144715 Publication Date 12/4/2018  Article
More Info.:Get all data from this article,  Assay Method
 
Oxysterols receptor LXR-beta
Name:Liver X receptor (LXR alpha AND LXR beta)
Synonyms:Liver X receptor beta (NR1H2) | Liver X, LXR beta | Oxysterols receptor LXR-beta
Type:Protein
Mol. Mass.:50978.79
Organism:Homo sapiens (Human)
Description:P55055
Residue:460
Sequence:
MSSPTTSSLDTPLPGNGPPQPGAPSSSPTVKEEGPEPWPGGPDPDVPGTDEASSACSTDW
VIPDPEEEPERKRKKGPAPKMLGHELCRVCGDKASGFHYNVLSCEGCKGFFRRSVVRGGA
RRYACRGGGTCQMDAFMRRKCQQCRLRKCKEAGMREQCVLSEEQIRKKKIRKQQQESQSQ
SQSPVGPQGSSSSASGPGASPGGSEAGSQGSGEGEGVQLTAAQELMIQQLVAAQLQCNKR
SFSDQPKVTPWPLGADPQSRDARQQRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQI
ALLKASTIEIMLLETARRYNHETECITFLKDFTYSKDDFHRAGLQVEFINPIFEFSRAMR
RLGLDDAEYALLIAINIFSADRPNVQEPGRVEALQQPYVEALLSYTRIKRPQDQLRFPRM
LMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDVHE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM304402
n/a
NameBDBM304402
Synonyms:(R)-2-fluoro-5-(4-(5-(2-hydroxypropan-2-yl)-4-(trifluoromethyl)pyrimidin-2-yl)-3-isopropylpiperazin-1-yl)-N-methylbenzenesulfonamide | US10144715, Compound 10-3
TypeSmall organic molecule
Emp. Form.C22H29F4N5O3S
Mol. Mass.519.556
SMILESCNS(=O)(=O)c1cc(ccc1F)N1CCN([C@@H](C1)C(C)C)c1ncc(c(n1)C(F)(F)F)C(C)(C)O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: