Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPlasma kallikrein
LigandBDBM306637
Substrate/Competitorn/a
Meas. Tech.In Vitro Plasma Kallikrein Inhibition Assay
IC50 0.759±n/a nM
Citation Li ZZancanella MYu CSetti LQSham HXu QYee CWYu M Bridged bicyclic kallikrein inhibitors US Patent  US10144746 Publication Date 12/4/2018
More Info.:Get all data from this article,  Assay Method
 
Plasma kallikrein
Name:Plasma kallikrein
Synonyms:Fletcher factor | Kallikrein | Kininogenin | Plasma kallikrein heavy chain | Plasma kallikrein light chain | Plasma prekallikrein
Type:Protein
Mol. Mass.:71391.16
Organism:Homo sapiens (Human)
Description:P03952
Residue:638
Sequence:
MILFKQATYFISLFATVSCGCLTQLYENAFFRGGDVASMYTPNAQYCQMRCTFHPRCLLF
SFLPASSINDMEKRFGCFLKDSVTGTLPKVHRTGAVSGHSLKQCGHQISACHRDIYKGVD
MRGVNFNVSKVSSVEECQKRCTNNIRCQFFSYATQTFHKAEYRNNCLLKYSPGGTPTAIK
VLSNVESGFSLKPCALSEIGCHMNIFQHLAFSDVDVARVLTPDAFVCRTICTYHPNCLFF
TFYTNVWKIESQRNVCLLKTSESGTPSSSTPQENTISGYSLLTCKRTLPEPCHSKIYPGV
DFGGEELNVTFVKGVNVCQETCTKMIRCQFFTYSLLPEDCKEEKCKCFLRLSMDGSPTRI
AYGTQGSSGYSLRLCNTGDNSVCTTKTSTRIVGGTNSSWGEWPWQVSLQVKLTAQRHLCG
GSLIGHQWVLTAAHCFDGLPLQDVWRIYSGILNLSDITKDTPFSQIKEIIIHQNYKVSEG
NHDIALIKLQAPLNYTEFQKPICLPSKGDTSTIYTNCWVTGWGFSKEKGEIQNILQKVNI
PLVTNEECQKRYQDYKITQRMVCAGYKEGGKDACKGDSGGPLVCKHNGMWRLVGITSWGE
GCARREQPGVYTKVAEYMDWILEKTQSSDGKAQMQSPA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM306637
n/a
NameBDBM306637
Synonyms:(1R,8S)-N-[(4-carbamimidoyl- 2,6-difluoro-phenyl)methyl]- 12-cyclopropyl-15-oxatetracyclo [6.6.1.02,7.09,14] pentadeca-2,4,6,9,11,13-hexaene- 4-carboxamide | US10144746, Compound 280
TypeSmall organic molecule
Emp. Form.C26H21F2N3O2
Mol. Mass.445.4606
SMILESNC(=N)c1cc(F)c(CNC(=O)c2ccc3[C@H]4O[C@H](c5cc(ccc45)C4CC4)c3c2)c(F)c1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: