Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPlasma kallikrein
LigandBDBM306658
Substrate/Competitorn/a
Meas. Tech.In Vitro Plasma Kallikrein Inhibition Assay
IC50 1.000±n/a nM
Citation Li ZZancanella MYu CSetti LQSham HXu QYee CWYu M Bridged bicyclic kallikrein inhibitors US Patent  US10144746 Publication Date 12/4/2018
More Info.:Get all data from this article,  Assay Method
 
Plasma kallikrein
Name:Plasma kallikrein
Synonyms:Fletcher factor | Kallikrein | Kininogenin | Plasma kallikrein heavy chain | Plasma kallikrein light chain | Plasma prekallikrein
Type:Protein
Mol. Mass.:71391.16
Organism:Homo sapiens (Human)
Description:P03952
Residue:638
Sequence:
MILFKQATYFISLFATVSCGCLTQLYENAFFRGGDVASMYTPNAQYCQMRCTFHPRCLLF
SFLPASSINDMEKRFGCFLKDSVTGTLPKVHRTGAVSGHSLKQCGHQISACHRDIYKGVD
MRGVNFNVSKVSSVEECQKRCTNNIRCQFFSYATQTFHKAEYRNNCLLKYSPGGTPTAIK
VLSNVESGFSLKPCALSEIGCHMNIFQHLAFSDVDVARVLTPDAFVCRTICTYHPNCLFF
TFYTNVWKIESQRNVCLLKTSESGTPSSSTPQENTISGYSLLTCKRTLPEPCHSKIYPGV
DFGGEELNVTFVKGVNVCQETCTKMIRCQFFTYSLLPEDCKEEKCKCFLRLSMDGSPTRI
AYGTQGSSGYSLRLCNTGDNSVCTTKTSTRIVGGTNSSWGEWPWQVSLQVKLTAQRHLCG
GSLIGHQWVLTAAHCFDGLPLQDVWRIYSGILNLSDITKDTPFSQIKEIIIHQNYKVSEG
NHDIALIKLQAPLNYTEFQKPICLPSKGDTSTIYTNCWVTGWGFSKEKGEIQNILQKVNI
PLVTNEECQKRYQDYKITQRMVCAGYKEGGKDACKGDSGGPLVCKHNGMWRLVGITSWGE
GCARREQPGVYTKVAEYMDWILEKTQSSDGKAQMQSPA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM306658
n/a
NameBDBM306658
Synonyms:(1R,8S)-N-[(4-carbamimidoyl-2- fluorophenyl)-methyl]-12- cyclopropyl-15-oxatetracyclo- [6.6.1.02,7.09,14]pentadeca- 2,4,6,9,11,13-hexaene-4- carboxamide | US10144746, Compound 302
TypeSmall organic molecule
Emp. Form.C26H22FN3O2
Mol. Mass.427.4702
SMILESNC(=N)c1ccc(CNC(=O)c2ccc3[C@H]4O[C@H](c5cc(ccc45)C4CC4)c3c2)c(F)c1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: