| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Enoyl-[acyl-carrier-protein] reductase [NADH] FabI |
|---|
| Ligand | BDBM8735 |
|---|
| Substrate/Competitor | BDBM8737 |
|---|
| Meas. Tech. | Enzyme Inhibition Assay |
|---|
| pH | 6.5±n/a |
|---|
| Temperature | 303.15±n/a K |
|---|
| IC50 | 30±5 nM |
|---|
| Citation |  Seefeld, MA; Miller, WH; Newlander, KA; Burgess, WJ; DeWolf, WE; Elkins, PA; Head, MS; Jakas, DR; Janson, CA; Keller, PM; Manley, PJ; Moore, TD; Payne, DJ; Pearson, S; Polizzi, BJ; Qiu, X; Rittenhouse, SF; Uzinskas, IN; Wallis, NG; Huffman, WF Indole naphthyridinones as inhibitors of bacterial enoyl-ACP reductases FabI and FabK. J Med Chem46:1627-35 (2003) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
|---|
| |
| Enoyl-[acyl-carrier-protein] reductase [NADH] FabI |
|---|
| Name: | Enoyl-[acyl-carrier-protein] reductase [NADH] FabI |
|---|
| Synonyms: | Enoyl - (acyl carrier protein) reductase | Enoyl-ACP Reductase (FabI) | Enoyl-[acyl-carrier-protein] reductase | Enoyl-acyl carrier protein reductase (FabI) | FABI_ECOLI | NADH-dependent enoyl-ACP reductase | envM | fabI |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 27861.12 |
|---|
| Organism: | Escherichia coli |
|---|
| Description: | n/a |
|---|
| Residue: | 262 |
|---|
| Sequence: | MGFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIV
LQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDIS
SYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPE
GVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGI
SGEVVHVDGGFSIAAMNELELK
|
|
|
|---|
| BDBM8735 |
|---|
| BDBM8737 |
|---|
| Name | BDBM8735 |
|---|
| Synonyms: | (2E)-N-[(1,2-dimethyl-1H-indol-3-yl)methyl]-N-methyl-3-(7-oxo-5,6,7,8-tetrahydro-1,8-naphthyridin-3-yl)prop-2-enamide | (E)-N-(1,2-Dimethyl-1H-indol-3-ylmethyl)-N-methyl-3-(7-oxo-5,6,7,8-tetrahydro-1,8-naphthyridin-3-yl)acrylamide | indole naphthyridinone 31 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H24N4O2 |
|---|
| Mol. Mass. | 388.4623 |
|---|
| SMILES | CN(Cc1c(C)n(C)c2ccccc12)C(=O)\C=C\c1cnc2NC(=O)CCc2c1 |
|---|
| Structure | 
|
|---|
Search and Browse
