Reaction Details |
| Report a problem with these data |
Target | Enoyl-[acyl-carrier-protein] reductase [NADH] FabI |
---|
Ligand | BDBM8736 |
---|
Substrate/Competitor | BDBM8737 |
---|
Meas. Tech. | Enzyme Inhibition Assay |
---|
pH | 6.5±n/a |
---|
Temperature | 303.15±n/a K |
---|
IC50 | <70±n/a nM |
---|
Citation | Seefeld, MA; Miller, WH; Newlander, KA; Burgess, WJ; DeWolf, WE; Elkins, PA; Head, MS; Jakas, DR; Janson, CA; Keller, PM; Manley, PJ; Moore, TD; Payne, DJ; Pearson, S; Polizzi, BJ; Qiu, X; Rittenhouse, SF; Uzinskas, IN; Wallis, NG; Huffman, WF Indole naphthyridinones as inhibitors of bacterial enoyl-ACP reductases FabI and FabK. J Med Chem46:1627-35 (2003) [PubMed] Article |
---|
More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
---|
|
Enoyl-[acyl-carrier-protein] reductase [NADH] FabI |
---|
Name: | Enoyl-[acyl-carrier-protein] reductase [NADH] FabI |
Synonyms: | Enoyl - (acyl carrier protein) reductase | Enoyl-ACP Reductase (FabI) | Enoyl-[acyl-carrier-protein] reductase | Enoyl-acyl carrier protein reductase (FabI) | FABI_ECOLI | NADH-dependent enoyl-ACP reductase | envM | fabI |
Type: | Enzyme |
Mol. Mass.: | 27861.12 |
Organism: | Escherichia coli |
Description: | n/a |
Residue: | 262 |
Sequence: | MGFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIV
LQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDIS
SYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPE
GVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGI
SGEVVHVDGGFSIAAMNELELK
|
|
|
BDBM8736 |
---|
BDBM8737 |
---|
Name | BDBM8736 |
Synonyms: | (2E)-N-methyl-3-(7-oxo-5,6,7,8-tetrahydro-1,8-naphthyridin-3-yl)-N-[(1,2,7-trimethyl-1H-indol-3-yl)methyl]prop-2-enamide | (E)-N-Methyl-3-(7-oxo-5,6,7,8-tetrahydro-1,8-naphthyridin-3-yl)-N-(1,2,7-trimethyl-1H-indol-3-ylmethyl)acrylamide | indole naphthyridinone 32 |
Type | Small organic molecule |
Emp. Form. | C24H26N4O2 |
Mol. Mass. | 402.4888 |
SMILES | CN(Cc1c(C)n(C)c2c(C)cccc12)C(=O)\C=C\c1cnc2NC(=O)CCc2c1 |
Structure |
|