Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytochrome P450 11B1, mitochondrial
LigandBDBM8611
Substrate/CompetitorBDBM8582
Meas. Tech.CYP11B Assay
pH7.4±n/a
Temperature310.15±n/a K
IC50 9.7±n/a nM
Citation Ulmschneider SMuller-Vieira UMitrenga MHartmann RWOberwinkler-Marchais SKlein CDBureik MBernhardt RAntes ILengauer T Synthesis and evaluation of imidazolylmethylenetetrahydronaphthalenes and imidazolylmethyleneindanes: potent inhibitors of aldosterone synthase. J Med Chem 48:1796-805 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Inhibition_Run data,   Solution Info,  Assay Method
 
Cytochrome P450 11B1, mitochondrial
Name:Cytochrome P450 11B1
Synonyms:CYPXIB1 | Cytochrome P450 11B, mitochondrial precursor | Cytochrome P450 11B1 | Cytochrome P450 11B1 (CYP11B1)
Type:Enzyme
Mol. Mass.:57591.44
Organism:Homo sapiens (Human)
Description:P15538
Residue:503
Sequence:
MALRAKAEVCMAVPWLSLQRAQALGTRAARVPRTVLPFEAMPRRPGNRWLRLLQIWREQG
YEDLHLEVHQTFQELGPIFRYDLGGAGMVCVMLPEDVEKLQQVDSLHPHRMSLEPWVAYR
QHRGHKCGVFLLNGPEWRFNRLRLNPEVLSPNAVQRFLPMVDAVARDFSQALKKKVLQNA
RGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFM
PRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFSRPQQYTSIVAELLLNAELS
PDAIKANSMELTAGSVDTTVFPLLMTLFELARNPNVQQALRQESLAAAASISEHPQKATT
ELPLLRAALKETLRLYPVGLFLERVASSDLVLQNYHIPAGTLVRVFLYSLGRNPALFPRP
ERYNPQRWLDIRGSGRNFYHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHLQVETLTQED
IKMVYSFILRPSMFPLLTFRAIN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM8611
BDBM8582
NameBDBM8611
Synonyms:4-{5H,6H,7H,8H-imidazo[1,5-a]pyridin-5-yl}benzonitrile | CHEMBL468419 | CHEMBL9298 | Fadrozole | US9271963, Fadrozole
TypeSmall organic molecule
Emp. Form.C14H13N3
Mol. Mass.223.2731
SMILESN#Cc1ccc(cc1)C1CCCc2cncn12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: