Reaction Details |
| Report a problem with these data |
Target | Leukotriene C4 synthase |
---|
Ligand | BDBM223234 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | In Vitro hLTC4 Synthase Enzyme Assay |
---|
IC50 | 24.0±n/a nM |
---|
Citation | Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Munck af Rosenschöld, M; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrchan, C Compounds and uses US Patent US9657001 Publication Date 5/23/2017 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Leukotriene C4 synthase |
---|
Name: | Leukotriene C4 synthase |
Synonyms: | LTC4 synthase | LTC4S | LTC4S_HUMAN | Leukotriene-C(4) synthase |
Type: | PROTEIN |
Mol. Mass.: | 16575.59 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_961179 |
Residue: | 150 |
Sequence: | MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYF
PLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVA
LAALGLLAHFLPAALRAALLGRLRTLLPWA
|
|
|
BDBM223234 |
---|
n/a |
---|
Name | BDBM223234 |
Synonyms: | 2-(5-((Cyclopropylmethyl)(naphthalen-1-yl)amino)-3-methoxypicolinoyl)cyclopropanecarboxylic acid | US20160326143, 9 | US9657001, 9 |
Type | Small Organic Molecule |
Emp. Form. | C25H24N2O4 |
Mol. Mass. | 416.4691 |
SMILES | COc1cc(cnc1C(=O)C1CC1C(O)=O)N(CC1CC1)c1cccc2ccccc12 |
Structure |
|