Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLeukotriene C4 synthase
LigandBDBM223261
Substrate/Competitorn/a
Meas. Tech.In Vitro hLTC4 Synthase Enzyme Assay
IC50 9.00±n/a nM
Citation Ronn RLindh CJRingberg EAndersson HBNilsson PSchaal WRMunck af Rosenschöld MNikitidis ANikitidis GJohannesson PTyrchan C Compounds and uses US Patent  US9657001 Publication Date 5/23/2017
More Info.:Get all data from this article,  Assay Method
 
Leukotriene C4 synthase
Name:Leukotriene C4 synthase
Synonyms:LTC4 synthase | LTC4S | Leukotriene-C(4) synthase
Type:PROTEIN
Mol. Mass.:16575.59
Organism:Homo sapiens (Human)
Description:ChEMBL_961179
Residue:150
Sequence:
MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYF
PLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVA
LAALGLLAHFLPAALRAALLGRLRTLLPWA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM223261
n/a
NameBDBM223261
Synonyms:2-(5-((Cyclopropylmethyl)(1,2-dihydroacenaphthylen-5-yl)amino)-3-methoxypicolinoyl)cyclopropanecarboxylic acid | US20160326143, 36 | US9657001, 36
TypeSmall Organic Molecule
Emp. Form.C27H26N2O4
Mol. Mass.442.5063
SMILESCOc1cc(cnc1C(=O)C1CC1C(O)=O)N(CC1CC1)c1ccc2CCc3cccc1c23
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: