Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHIV-1 Protease
LigandBDBM9093
Substrate/CompetitorHIV Protease Peptide Substrate
Meas. Tech.Protease Inhibition Assay
pH5.5±n/a
Temperature303.15±n/a K
IC50 0.03±n/a nM
Citation Lu ZBohn JRano TRutkowski CASimcoe ALOlsen DBSchleif WACarella AGabryelski LJin LLin JHEmini EChapman KTata JR Orally bioavailable highly potent HIV protease inhibitors against PI-resistant virus. Bioorg Med Chem Lett 15:5311-4 (2005) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
HIV-1 Protease
Name:HIV-1 Protease
Synonyms:HIV-1 Protease NL4-3 | HIV-1 protease wild-type
Type:Protein Complex
Mol. Mass.:n/a
Description:n/a
Components:This complex has 2 components.
Component 1
Name:HIV-1 Protease Chain A
Synonyms:HIV-1 Protease NL4-3
Type:Enzyme Subunit
Mol. Mass.:10823.26
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQITLWKRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:HIV-1 Protease Chain A
Synonyms:HIV-1 Protease NL4-3
Type:Enzyme Subunit
Mol. Mass.:10823.26
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQITLWKRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM9093
HIV Protease Peptide Substrate
Name:HIV Protease Peptide Substrate
Synonyms:HIV Protease Substrate
Type:Peptide
Mol. Mass.:2715.95
Organism:n/a
Description:n/a
Residue:25
Sequence:
VSQN-(beta-naphthylalanine)-PIV