Reaction Details |
 | Report a problem with these data |
Target | HIV-1 Protease |
---|
Ligand | BDBM9105 |
---|
Substrate/Competitor | HIV Protease Peptide Substrate |
---|
Meas. Tech. | Protease Inhibition Assay |
---|
pH | 5.5±n/a |
---|
Temperature | 303.15±n/a K |
---|
IC50 | 0.024±n/a nM |
---|
Citation | Kim RM; Rouse EA; Chapman KT; Schleif WA; Olsen DB; Stahlhut M; Rutkowski CA; Emini EA; Tata JR P1' oxadiazole protease inhibitors with excellent activity against native and protease inhibitor-resistant HIV-1. Bioorg Med Chem Lett 14:4651-4 (2004) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
HIV-1 Protease |
---|
Name: | HIV-1 Protease |
Synonyms: | HIV-1 Protease NL4-3 | HIV-1 protease wild-type |
Type: | Protein Complex |
Mol. Mass.: | n/a |
Description: | n/a |
Components: | This complex has 2 components. |
Component 1 |
Name: | HIV-1 Protease Chain A |
Synonyms: | HIV-1 Protease NL4-3 |
Type: | Enzyme Subunit |
Mol. Mass.: | 10823.26 |
Organism: | Human immunodeficiency virus type 1 |
Description: | n/a |
Residue: | 99 |
Sequence: | PQITLWKRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
Component 2 |
Name: | HIV-1 Protease Chain A |
Synonyms: | HIV-1 Protease NL4-3 |
Type: | Enzyme Subunit |
Mol. Mass.: | 10823.26 |
Organism: | Human immunodeficiency virus type 1 |
Description: | n/a |
Residue: | 99 |
Sequence: | PQITLWKRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM9105 |
---|
HIV Protease Peptide Substrate |
---|
Name: | HIV Protease Peptide Substrate |
Synonyms: | HIV Protease Substrate |
Type: | Peptide |
Mol. Mass.: | 2715.95 |
Organism: | n/a |
Description: | n/a |
Residue: | 25 |
Sequence: | VSQN-(beta-naphthylalanine)-PIV
|
|
|