Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHIV-1 Protease Mutant K-60C
LigandBDBM517
Substrate/CompetitorHIV Protease Peptide Substrate
Meas. Tech.Protease Inhibition Assay
IC50 61.2±n/a nM
Citation Kevin NJDuffy JLKirk BAChapman KTSchleif WAOlsen DBStahlhut MRutkowski CAKuo LCJin LLin JHEmini EATata JR Novel HIV-1 protease inhibitors active against multiple PI-resistant viral strains: coadministration with indinavir. Bioorg Med Chem Lett 13:4027-30 (2003) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
HIV-1 Protease Mutant K-60C
Name:HIV-1 Protease Mutant K-60C
Synonyms:HIV-1 Protease Mutant (L10I/M46I/I54V/Q58E/L63P/I64V/V77I/V82F/I84V/L90M/I93L)
Type:Protein Complex
Mol. Mass.:n/a
Description:n/a
Components:This complex has 2 components.
Component 1
Name:HIV-1 Protease Mutant K-60C Chain A
Synonyms:HIV-1 Protease Mutant K-60C Chain B
Type:Enzyme Subunit
Mol. Mass.:10827.19
Organism:Human immunodeficiency virus type 1
Description:L10I,M46I,I54V,Q58E,L63P,I64V,V77I,V82F,I84V,L90M,I93L
Residue:99
Sequence:
PQITLWKRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFVKVREYD
QIPVEICGHKAIGTVLIGPTPFNVIGRNLMTQLGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:HIV-1 Protease Mutant K-60C Chain A
Synonyms:HIV-1 Protease Mutant K-60C Chain B
Type:Enzyme Subunit
Mol. Mass.:10827.19
Organism:Human immunodeficiency virus type 1
Description:L10I,M46I,I54V,Q58E,L63P,I64V,V77I,V82F,I84V,L90M,I93L
Residue:99
Sequence:
PQITLWKRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFVKVREYD
QIPVEICGHKAIGTVLIGPTPFNVIGRNLMTQLGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM517
HIV Protease Peptide Substrate
Name:HIV Protease Peptide Substrate
Synonyms:HIV Protease Substrate
Type:Peptide
Mol. Mass.:2715.95
Organism:n/a
Description:n/a
Residue:25
Sequence:
VSQN-(beta-naphthylalanine)-PIV