| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dimer of Gag-Pol polyprotein [489-587,Q496K,L499I,N526S,R530K,M535I,I543V,I551V,L552P,A560V,V566I,V571A,L579M,I582L] |
|---|
| Ligand | BDBM517 |
|---|
| Substrate/Competitor | HIV Protease Peptide Substrate |
|---|
| Meas. Tech. | Protease Inhibition Assay |
|---|
| pH | 5.5±n/a |
|---|
| Temperature | 303.15±n/a K |
|---|
| IC50 | 20.1±n/a nM |
|---|
| Citation |  Duffy, JL; Rano, TA; Kevin, NJ; Chapman, KT; Schleif, WA; Olsen, DB; Stahlhut, M; Rutkowski, CA; Kuo, LC; Jin, L; Lin, JH; Emini, EA; Tata, JR HIV protease inhibitors with picomolar potency against PI-Resistant HIV-1 by extension of the P3 substituent. Bioorg Med Chem Lett13:2569-72 (2003) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Dimer of Gag-Pol polyprotein [489-587,Q496K,L499I,N526S,R530K,M535I,I543V,I551V,L552P,A560V,V566I,V571A,L579M,I582L] |
|---|
| Name: | Dimer of Gag-Pol polyprotein [489-587,Q496K,L499I,N526S,R530K,M535I,I543V,I551V,L552P,A560V,V566I,V571A,L579M,I582L] |
|---|
| Synonyms: | HIV-1 Protease Mutant (L10I/N37S/R41K/M46I/I54V/I62V/L63P/A71V/V77I/V82A/L90M/I93L) | HIV-1 Protease Mutant Q-60C |
|---|
| Type: | Protein Complex |
|---|
| Mol. Mass.: | n/a |
|---|
| Description: | n/a |
|---|
| Components: | This complex has 2 components. |
|---|
| Component 1 |
| Name: | Gag-Pol polyprotein [489-587,Q496K,L499I,N526S,R530K,M535I,I543V,I551V,L552P,A560V,V566I,V571A,L579M,I582L] |
|---|
| Synonyms: | HIV-1 Protease Mutant Q-60C Chain A | HIV-1 Protease Mutant Q-60C Chain B | POL_HV1N5 | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10738.15 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | L10I/N37S/R41K/M46I/I54V/I62V/L63P/A71V/V77I/V82A/L90M/I93L |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQITLWKRPIVTIKIGGQLKEALLDTGADDTVLEEMSLPGKWKPKIIGGIGGFVKVRQYD
QVPIEICGHKVIGTVLIGPTPANIIGRNLMTQLGCTLNF
|
|
|
|---|
| Component 2 |
| Name: | Gag-Pol polyprotein [489-587,Q496K,L499I,N526S,R530K,M535I,I543V,I551V,L552P,A560V,V566I,V571A,L579M,I582L] |
|---|
| Synonyms: | HIV-1 Protease Mutant Q-60C Chain A | HIV-1 Protease Mutant Q-60C Chain B | POL_HV1N5 | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10738.15 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | L10I/N37S/R41K/M46I/I54V/I62V/L63P/A71V/V77I/V82A/L90M/I93L |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQITLWKRPIVTIKIGGQLKEALLDTGADDTVLEEMSLPGKWKPKIIGGIGGFVKVRQYD
QVPIEICGHKVIGTVLIGPTPANIIGRNLMTQLGCTLNF
|
|
|
|---|
| BDBM517 |
|---|
| HIV Protease Peptide Substrate |
|---|
| Name: | HIV Protease Peptide Substrate |
|---|
| Synonyms: | HIV Protease Substrate |
|---|
| Type: | Peptide |
|---|
| Mol. Mass.: | 2715.95 |
|---|
| Organism: | n/a |
|---|
| Description: | n/a |
|---|
| Residue: | 25 |
|---|
| Sequence: | VSQN-(beta-naphthylalanine)-PIV
|
|
|
|---|
Search and Browse
