Reaction Details |
| Report a problem with these data |
Target | Dimer of Gag-Pol polyprotein [489-587,Q496K,L499I,N526S,R530K,M535I,I543V,I551V,L552P,A560V,V566I,V571A,L579M,I582L] |
---|
Ligand | BDBM9157 |
---|
Substrate/Competitor | HIV Protease Peptide Substrate |
---|
Meas. Tech. | Protease Inhibition Assay |
---|
IC50 | 2.7±n/a nM |
---|
Citation | Duffy, JL; Kirk, BA; Kevin, NJ; Chapman, KT; Schleif, WA; Olsen, DB; Stahlhut, M; Rutkowski, CA; Kuo, LC; Jin, L; Lin, JH; Emini, EA; Tata, JR HIV-1 protease inhibitors with picomolar potency against PI-resistant HIV-1 by modification of the P1' substituent. Bioorg Med Chem Lett13:3323-6 (2003) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Dimer of Gag-Pol polyprotein [489-587,Q496K,L499I,N526S,R530K,M535I,I543V,I551V,L552P,A560V,V566I,V571A,L579M,I582L] |
---|
Name: | Dimer of Gag-Pol polyprotein [489-587,Q496K,L499I,N526S,R530K,M535I,I543V,I551V,L552P,A560V,V566I,V571A,L579M,I582L] |
Synonyms: | HIV-1 Protease Mutant (L10I/N37S/R41K/M46I/I54V/I62V/L63P/A71V/V77I/V82A/L90M/I93L) | HIV-1 Protease Mutant Q-60C |
Type: | Protein Complex |
Mol. Mass.: | n/a |
Description: | n/a |
Components: | This complex has 2 components. |
Component 1 |
Name: | Gag-Pol polyprotein [489-587,Q496K,L499I,N526S,R530K,M535I,I543V,I551V,L552P,A560V,V566I,V571A,L579M,I582L] |
Synonyms: | HIV-1 Protease Mutant Q-60C Chain A | HIV-1 Protease Mutant Q-60C Chain B | POL_HV1N5 | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10738.15 |
Organism: | Human immunodeficiency virus type 1 |
Description: | L10I/N37S/R41K/M46I/I54V/I62V/L63P/A71V/V77I/V82A/L90M/I93L |
Residue: | 99 |
Sequence: | PQITLWKRPIVTIKIGGQLKEALLDTGADDTVLEEMSLPGKWKPKIIGGIGGFVKVRQYD
QVPIEICGHKVIGTVLIGPTPANIIGRNLMTQLGCTLNF
|
|
|
Component 2 |
Name: | Gag-Pol polyprotein [489-587,Q496K,L499I,N526S,R530K,M535I,I543V,I551V,L552P,A560V,V566I,V571A,L579M,I582L] |
Synonyms: | HIV-1 Protease Mutant Q-60C Chain A | HIV-1 Protease Mutant Q-60C Chain B | POL_HV1N5 | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10738.15 |
Organism: | Human immunodeficiency virus type 1 |
Description: | L10I/N37S/R41K/M46I/I54V/I62V/L63P/A71V/V77I/V82A/L90M/I93L |
Residue: | 99 |
Sequence: | PQITLWKRPIVTIKIGGQLKEALLDTGADDTVLEEMSLPGKWKPKIIGGIGGFVKVRQYD
QVPIEICGHKVIGTVLIGPTPANIIGRNLMTQLGCTLNF
|
|
|
BDBM9157 |
---|
HIV Protease Peptide Substrate |
---|
Name: | HIV Protease Peptide Substrate |
Synonyms: | HIV Protease Substrate |
Type: | Peptide |
Mol. Mass.: | 2715.95 |
Organism: | n/a |
Description: | n/a |
Residue: | 25 |
Sequence: | VSQN-(beta-naphthylalanine)-PIV
|
|
|