Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEZH2(Y641F)
LigandBDBM172038
Substrate/Competitorn/a
Meas. Tech.PRC2 Enzyme Assays
IC50 12.7±n/a nM
Citation Kuntz KWChesworth RDuncan KWKeilhack HWarholic NKlaus CKnutson SKWigle TJSeki MShirotori SKawano S Aryl- or heteroaryl-substituted benzene compounds US Patent  US10155002 Publication Date 12/18/2018
More Info.:Get all data from this article,  Assay Method
 
EZH2(Y641F)
Name:EZH2(Y641F)
Synonyms:Histone-lysine N-methyltransferase EZH2 (Y641F)
Type:n/a
Mol. Mass.:85351.84
Organism:Homo sapiens (Human)
Description:TL
Residue:746
Sequence:
MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQEW
KQRRIQPVHILTSVSSLRGTRECSVTSDLDFPTQVIPLKTLNAVASVPIMYSWSPLQQNF
MVEDETVLHNIPYMGDEVLDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQ
YNDDDDDDDGDDPEEREEKQKDLEDHRDDKESRPPRKFPSDKIFEAISSMFPDKGTAEEL
KEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYDCFLHPFH
ATPNTYKRKNTETALDNKPCGPQCYQHLEGAKEFAAALTAERIKTPPKRPGGRRRGRLPN
NSSRPSTPTINVLESKDTDSDREAGTETGGENNDKEEEEKKDETSSSSEANSRCQTPIKM
KPNIEPPENVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIAPA
PAEDVDTPPRKKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSSCPCVIAQ
NFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVS
CKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEFCGEIISQDEADRRGKVYDK
YMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGE
ELFFDYRYSQADALKYVGIEREMEIP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM172038
n/a
NameBDBM172038
Synonyms:US10155002, Compound 44 | US9090562, 143 | US9090562, 44 | US9394283, 1
TypeSmall organic molecule
Emp. Form.C34H44N4O4
Mol. Mass.572.7376
SMILESCCN(C1CCOCC1)c1cc(cc(C(=O)NCc2c(C)cc(C)[nH]c2=O)c1C)-c1ccc(CN2CCOCC2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: