Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHIV-1 Protease
LigandBDBM520
Substrate/CompetitorHIV Protease substrate
Meas. Tech.Protease Inhibition Assay
pH6.4±n/a
Temperature298.15±n/a K
Ki 0.02±n/a nM
Citation Spaltenstein AAlmond MRBock WJCleary DGFurfine ESHazen RJKazmierski WMSalituro FGTung RDWright LL Novel inhibitors of HIV protease: design, synthesis and biological evaluation of picomolar inhibitors containing cyclic P1/P2 scaffolds. Bioorg Med Chem Lett 10:1159-62 (2000) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
HIV-1 Protease
Name:HIV-1 Protease
Synonyms:n/a
Type:Protein Complex
Mol. Mass.:n/a
Description:n/a
Components:This complex has 2 components.
Component 1
Name:HIV-1 Protease chain A
Synonyms:n/a
Type:Enzyme Subunit
Mol. Mass.:10732.11
Organism:Human immunodeficiency virus type 1
Description:The HIV-1 protease (Genbank HIVHXB2CG) clone was constructed with the substitutions Q7K, L33I, and L63I, to minimize the autoproteolysis of the protease, and C67A and C95A, to prevent cysteine-thiol oxidation.
Residue:99
Sequence:
PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYD
QIIIEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:HIV-1 Protease chain A
Synonyms:n/a
Type:Enzyme Subunit
Mol. Mass.:10732.11
Organism:Human immunodeficiency virus type 1
Description:The HIV-1 protease (Genbank HIVHXB2CG) clone was constructed with the substitutions Q7K, L33I, and L63I, to minimize the autoproteolysis of the protease, and C67A and C95A, to prevent cysteine-thiol oxidation.
Residue:99
Sequence:
PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYD
QIIIEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM520
HIV Protease substrate
Name:HIV Protease substrate
Synonyms:Fluorogenic Peptide Substrate
Type:Peptide
Mol. Mass.:3467.28
Organism:n/a
Description:n/a
Residue:30
Sequence:
2-(aminobenzoyl)-Thr-Ile-Nle-Phe(p-NO2)-Gln-ArgNH2