| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dimer of Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM519 |
|---|
| Substrate/Competitor | HIV Protease Peptide Substrate |
|---|
| Meas. Tech. | Protease Inhibition Assay |
|---|
| pH | 5.5±n/a |
|---|
| Temperature | 303.15±n/a K |
|---|
| IC50 | 0.23±0.1 nM |
|---|
| Citation |  Ghosh, AK; Thompson, WJ; Holloway, MK; McKee, SP; Duong, TT; Lee, HY; Munson, PM; Smith, AM; Wai, JM; Darke, PL Potent HIV protease inhibitors: the development of tetrahydrofuranylglycines as novel P2-ligands and pyrazine amides as P3-ligands. J Med Chem36:2300-10 (1993) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
|---|
| |
| Dimer of Gag-Pol polyprotein [489-587] |
|---|
| Name: | Dimer of Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | HIV-1 Protease |
|---|
| Type: | Protein Complex |
|---|
| Mol. Mass.: | n/a |
|---|
| Description: | n/a |
|---|
| Components: | This complex has 2 components. |
|---|
| Component 1 |
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | HIV protease | HIV-1 Protease (NY5-type sequence) | HIV-1 Protease chain A | HIV-1 Protease chain B | POL_HV1N5 | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10822.21 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P12497[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| Component 2 |
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | HIV protease | HIV-1 Protease (NY5-type sequence) | HIV-1 Protease chain A | HIV-1 Protease chain B | POL_HV1N5 | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10822.21 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P12497[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM519 |
|---|
| HIV Protease Peptide Substrate |
|---|
| Name: | HIV Protease Peptide Substrate |
|---|
| Synonyms: | HIV Protease Substrate |
|---|
| Type: | Peptide |
|---|
| Mol. Mass.: | 2715.95 |
|---|
| Organism: | n/a |
|---|
| Description: | n/a |
|---|
| Residue: | 25 |
|---|
| Sequence: | VSQN-(beta-naphthylalanine)-PIV
|
|
|
|---|
Search and Browse
