| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Histone acetyltransferase KAT2B [719-832] |
|---|
| Ligand | BDBM311424 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | PCAF AlphaLisa Binding Assay |
|---|
| IC50 | 57.0±n/a nM |
|---|
| Citation |  Albrecht, BK; Cote, A; Crawford, T; Duplessis, M; Good, AC; LeBlanc, Y; Magnuson, S; Nasveschuk, CG; Pastor, R; Romero, AF; Taylor, AM Therapeutic compounds and uses thereof US Patent US10155764 Publication Date 12/18/2018 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Histone acetyltransferase KAT2B [719-832] |
|---|
| Name: | Histone acetyltransferase KAT2B [719-832] |
|---|
| Synonyms: | KAT2B | KAT2B_HUMAN | PCAF | PCAF (aa 719-832) |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 13623.13 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q92831[719-832] |
|---|
| Residue: | 114 |
|---|
| Sequence: | SKEPRDPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLK
NRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLIDK
|
|
|
|---|
| BDBM311424 |
|---|
| n/a |
|---|
| Name | BDBM311424 |
|---|
| Synonyms: | US10155764, Example 16A |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H21N5O |
|---|
| Mol. Mass. | 287.3601 |
|---|
| SMILES | CN(C)[C@H]1CCC[C@H]1Nc1nn(C)c(=O)c2cccnc12 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
