Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetInterleukin-1 receptor-associated kinase 4
LigandBDBM311525
Substrate/Competitorn/a
Meas. Tech.IRAK4 Kinase Assay
IC50 0.700±n/a nM
Citation Lim JAltman MDChilders MLGibeau CRHo GDTsui H Carboxamide inhibitors of IRAK4 activity US Patent  US10155765 Publication Date 12/18/2018
More Info.:Get all data from this article,  Assay Method
 
Interleukin-1 receptor-associated kinase 4
Name:Interleukin-1 receptor-associated kinase 4
Synonyms:IRAK-4 | Interleukin-1 receptor-associated kinase 4 (IRAK-4) | Interleukin-1 receptor-associated kinase 4 (IRAK4) | Renal carcinoma antigen NY-REN-64
Type:Protein
Mol. Mass.:51519.08
Organism:Homo sapiens (Human)
Description:Q9NWZ3
Residue:460
Sequence:
MNKPITPSTYVRCLNVGLIRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALL
QTGKSPTSELLFDWGTTNCTVGDLVDLLIQNEFFAPASLLLPDAVPKTANTLPSKEAITV
QQKQMPFCDKDRTLMTPVQNLEQSYMPPDSSSPENKSLEVSDTRFHSFSFYELKNVTNNF
DERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKLAAMVDITTEELKQQFDQEIKVMAKC
QHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGIN
FLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEKFAQTVMTSRIVGTTAYMAPEAL
RGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMND
ADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMTAS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM311525
n/a
NameBDBM311525
Synonyms:5-[(2- aminoethyl)amino]-N- (3-carbamoyl-1-pyridin- 3-yl-1H-pyrazol-4- yl)pyrazolo[1,5- a]pyrimidine-3- carboxamide | US10155765, Example 11
TypeSmall organic molecule
Emp. Form.C18H18N10O2
Mol. Mass.406.4013
SMILESNCCNc1ccn2ncc(C(=O)Nc3cn(nc3C(N)=O)-c3cccnc3)c2n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: