Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetInterleukin-1 receptor-associated kinase 4
LigandBDBM311561
Substrate/Competitorn/a
Meas. Tech.IRAK4 Kinase Assay
IC50 2.00±n/a nM
Citation Lim JAltman MDChilders MLGibeau CRHo GDTsui H Carboxamide inhibitors of IRAK4 activity US Patent  US10155765 Publication Date 12/18/2018
More Info.:Get all data from this article,  Assay Method
 
Interleukin-1 receptor-associated kinase 4
Name:Interleukin-1 receptor-associated kinase 4
Synonyms:IRAK-4 | Interleukin-1 receptor-associated kinase 4 (IRAK-4) | Interleukin-1 receptor-associated kinase 4 (IRAK4) | Renal carcinoma antigen NY-REN-64
Type:Protein
Mol. Mass.:51519.08
Organism:Homo sapiens (Human)
Description:Q9NWZ3
Residue:460
Sequence:
MNKPITPSTYVRCLNVGLIRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALL
QTGKSPTSELLFDWGTTNCTVGDLVDLLIQNEFFAPASLLLPDAVPKTANTLPSKEAITV
QQKQMPFCDKDRTLMTPVQNLEQSYMPPDSSSPENKSLEVSDTRFHSFSFYELKNVTNNF
DERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKLAAMVDITTEELKQQFDQEIKVMAKC
QHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGIN
FLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEKFAQTVMTSRIVGTTAYMAPEAL
RGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMND
ADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMTAS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM311561
n/a
NameBDBM311561
Synonyms:2-[(2- aminoethyl)amino]-N- [3-carbamoyl-1-(2- hydroxyethyl)-1H- pyrazol-4- yl]pyrrolo[2,1- f][1,2,4]triazine-7- carboxamide trifluoroacetate | US10155765, Example 59
TypeSmall organic molecule
Emp. Form.C15H19N9O3
Mol. Mass.373.3699
SMILESNCCNc1ncc2ccc(C(=O)Nc3cn(CCO)nc3C(N)=O)n2n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: