Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRET kinase mutant (V804M)
LigandBDBM311700
Substrate/Competitorn/a
Meas. Tech.Measurement of Inhibitory Activity Against RET (V804M)
IC50 0.600±n/a nM
Citation Miyazaki IShimamura TKato MFujita HIguchi S Fused pyrimidine compound or salt thereof US Patent  US10155768 Publication Date 12/18/2018
More Info.:Get all data from this article,  Assay Method
 
RET kinase mutant (V804M)
Name:RET kinase mutant (V804M)
Synonyms:ret enzyme (v804m)
Type:Enzyme Catalytic Domain
Mol. Mass.:124350.36
Organism:Homo sapiens (Human)
Description:n/a
Residue:1114
Sequence:
MAKATSGAAGLRLLLLLLLPLLGKVALGLYFSRDAYWEKLYVDQAAGTPLLYVHALRDAP
EEVPSFRLGQHLYGTYRTRLHENNWICIQEDTGLLYLNRSLDHSSWEKLSVRNRGFPLLT
VYLKVFLSPTSLREGECQWPGCARVYFSFFNTSFPACSSLKPRELCFPETRPSFRIRENR
PPGTFHQFRLLPVQFLCPNISVAYRLLEGEGLPFRCAPDSLEVSTRWALDREQREKYELV
AVCTVHAGAREEVVMVPFPVTVYDEDDSAPTFPAGVDTASAVVEFKRKEDTVVATLRVFD
ADVVPASGELVRRYTSTLLPGDTWAQQTFRVEHWPNETSVQANGSFVRATVHDYRLVLNR
NLSISENRTMQLAVLVNDSDFQGPGAGVLLLHFNVSVLPVSLHLPSTYSLSVSRRARRFA
QIGKVCVENCQAFSGINVQYKLHSSGANCSTLGVVTSAEDTSGILFVNDTKALRRPKCAE
LHYMVVATDQQTSRQAQAQLLVTVEGSYVAEEAGCPLSCAVSKRRLECEECGGLGSPTGR
CEWRQGDGKGITRNFSTCSPSTKTCPDGHCDVVETQDINICPQDCLRGSIVGGHEPGEPR
GIKAGYGTCNCFPEEEKCFCEPEDIQDPLCDELCRTVIAAAVLFSFIVSVLLSAFCIHCY
HKFAHKPPISSAEMTFRRPAQAFPVSYSSSGARRPSLDSMENQVSVDAFKILEDPKWEFP
RKNLVLGKTLGEGEFGKVVKATAFHLKGRAGYTTVAVKMLKENASPSELRDLLSEFNVLK
QVNHPHVIKLYGACSQDGPLLLIMEYAKYGSLRGFLRESRKVGPGYLGSGGSRNSSSLDH
PDERALTMGDLISFAWQISQGMQYLAEMKLVHRDLAARNILVAEGRKMKISDFGLSRDVY
EEDSYVKRSQGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIPPERL
FNLLKTGHRMERPDNCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKMMVKRRDYLDLAA
STPSDSLIYDDGLSEEETPLVDCNNAPLPRALPSTWIENKLYGMSDPNWPGESPVPLTRA
DGTNTGFPRYPNDSVYANWMLSPSAAKLMDTFDS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM311700
n/a
NameBDBM311700
Synonyms:Ex. Cpd. 152
TypeSmall organic molecule
Emp. Form.C27H31N5O3
Mol. Mass.473.5667
SMILESCOCc1ccc(NC(=O)c2c(C#CCC3CCOCC3)n(c3ncnc(N)c23)C2(C)CC2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: