Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVoltage-dependent calcium channel gamma-2 subunit
LigandBDBM311829
Substrate/Competitorn/a
Meas. Tech.Calcium Flux Assay
IC50 0.126±n/a nM
Citation Ameriks MKLaforteza BNLebold TPRavula SSavall BMShireman BT Fused azaheterocyclic compounds and their use as AMPA receptor modulators US Patent  US10155769 Publication Date 12/18/2018
More Info.:Get all data from this article,  Assay Method
 
Voltage-dependent calcium channel gamma-2 subunit
Name:Voltage-dependent calcium channel gamma-2 subunit
Synonyms:CACNG2 | Neuronal voltage-gated calcium channel gamma-2 subunit | TARP gamma-2 | Transmembrane AMPAR regulatory protein gamma-2
Type:Enzyme Catalytic Domain
Mol. Mass.:35977.54
Organism:Homo sapiens (Human)
Description:n/a
Residue:323
Sequence:
MGLFDRGVQMLLTTVGAFAAFSLMTIAVGTDYWLYSRGVCKTKSVSENETSKKNEEVMTH
SGLWRTCCLEGNFKGLCKQIDHFPEDADYEADTAEYFLRAVRASSIFPILSVILLFMGGL
CIAASEFYKTRHNIILSAGIFFVSAGLSNIIGIIVYISANAGDPSKSDSKKNSYSYGWSF
YFGALSFIIAEMVGVLAVHMFIDRHKQLRATARATDYLQASAITRIPSYRYRYQRRSRSS
SRSTEPSHSRDASPVGIKGFNTLPSTEISMYTLSRDPLKAATTPTATYNSDRDNSFLQVH
NCIQKENKDSLHSNTANRRTTPV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM311829
n/a
NameBDBM311829
Synonyms:8-(7-Chloro-1H-indazol-5-yl)-2-cyclopropyl-7-(trifluoromethyl)imidazo[1,2-c]pyrimidine | US10155769, Example 67
TypeSmall organic molecule
Emp. Form.C17H11ClF3N5
Mol. Mass.377.751
SMILESFC(F)(F)c1ncn2cc(nc2c1-c1cc(Cl)c2[nH]ncc2c1)C1CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: