Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHIV-1 Protease
LigandBDBM9670
Substrate/CompetitorChromogenic Peptide Substrate
Meas. Tech.Protease Inhibition Assay
Ki 10±n/a nM
Citation Melnick MReich SHLewis KKMitchell LJNguyen DTrippe AJDawson HDavies JFAppelt KWu BWMusick LGehlhaar DKWebber SShetty BKosa MKahil DAndrada D Bis tertiary amide inhibitors of the HIV-1 protease generated via protein structure-based iterative design. J Med Chem 39:2795-811 (1996) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
HIV-1 Protease
Name:HIV-1 Protease
Synonyms:n/a
Type:Protein Complex
Mol. Mass.:n/a
Description:n/a
Components:This complex has 2 components.
Component 1
Name:HIV-1 Protease chain A
Synonyms:HIV-1 Protease (NY5-type sequence)
Type:Enzyme Subunit
Mol. Mass.:10822.21
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:HIV-1 Protease chain A
Synonyms:HIV-1 Protease (NY5-type sequence)
Type:Enzyme Subunit
Mol. Mass.:10822.21
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM9670
Chromogenic Peptide Substrate
Name:Chromogenic Peptide Substrate
Synonyms:n/a
Type:Peptide
Mol. Mass.:3763.66
Organism:n/a
Description:n/a
Residue:35
Sequence:
His-Lys-Ala-Arg-Val-Leu-Phe(p-NO2)-Glu-Ala-Nle-Ser-NH2