Reaction Details |
| Report a problem with these data |
Target | Dimer of Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM9671 |
---|
Substrate/Competitor | Chromogenic Peptide Substrate |
---|
Meas. Tech. | Protease Inhibition Assay |
---|
Ki | 51±n/a nM |
---|
Citation | Melnick, M; Reich, SH; Lewis, KK; Mitchell, LJ; Nguyen, D; Trippe, AJ; Dawson, H; Davies, JF; Appelt, K; Wu, BW; Musick, L; Gehlhaar, DK; Webber, S; Shetty, B; Kosa, M; Kahil, D; Andrada, D Bis tertiary amide inhibitors of the HIV-1 protease generated via protein structure-based iterative design. J Med Chem39:2795-811 (1996) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Dimer of Gag-Pol polyprotein [489-587] |
---|
Name: | Dimer of Gag-Pol polyprotein [489-587] |
Synonyms: | HIV-1 Protease |
Type: | Protein Complex |
Mol. Mass.: | n/a |
Description: | n/a |
Components: | This complex has 2 components. |
Component 1 |
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | HIV protease | HIV-1 Protease (NY5-type sequence) | HIV-1 Protease chain A | HIV-1 Protease chain B | POL_HV1N5 | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10822.21 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P12497[489-587] |
Residue: | 99 |
Sequence: | PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
Component 2 |
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | HIV protease | HIV-1 Protease (NY5-type sequence) | HIV-1 Protease chain A | HIV-1 Protease chain B | POL_HV1N5 | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10822.21 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P12497[489-587] |
Residue: | 99 |
Sequence: | PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM9671 |
---|
Chromogenic Peptide Substrate |
---|
Name: | Chromogenic Peptide Substrate |
Synonyms: | n/a |
Type: | Peptide |
Mol. Mass.: | 3763.66 |
Organism: | n/a |
Description: | n/a |
Residue: | 35 |
Sequence: | His-Lys-Ala-Arg-Val-Leu-Phe(p-NO2)-Glu-Ala-Nle-Ser-NH2
|
|
|