Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAmine oxidase [flavin-containing] A
LigandBDBM179652
Substrate/Competitorn/a
Meas. Tech.Monoamine Oxidase Assays
pH7.5±n/a
Ki>1000±n/a nM
Commentsextracted
Citation Fyfe MCOrtega Muñoz ACastro-Palomino Laria JMartinell Pedemonte MEstiarte-Martinez MValls Vidal N Cyclopropylamine derivatives useful as LSD1 inhibitors US Patent  US9676701 Publication Date 6/13/2017
More Info.:Get all data from this article,  Assay Method
 
Amine oxidase [flavin-containing] A
Name:Amine oxidase [flavin-containing] A
Synonyms:Amine oxidase (flavin-containing) A | MAO-A | Monoamine oxidase | Monoamine oxidase type A | Monoamine oxidase type A (MAO A) | Monoamine oxidase type A (MAO A) | Monoamine oxidase type A (MAOA)
Type:Protein
Mol. Mass.:59689.53
Organism:Homo sapiens (Human)
Description:P21397
Residue:527
Sequence:
MENQEKASIAGHMFDVVVIGGGISGLSAAKLLTEYGVSVLVLEARDRVGGRTYTIRNEHV
DYVDVGGAYVGPTQNRILRLSKELGIETYKVNVSERLVQYVKGKTYPFRGAFPPVWNPIA
YLDYNNLWRTIDNMGKEIPTDAPWEAQHADKWDKMTMKELIDKICWTKTARRFAYLFVNI
NVTSEPHEVSALWFLWYVKQCGGTTRIFSVTNGGQERKFVGGSGQVSERIMDLLGDQVKL
NHPVTHVDQSSDNIIIETLNHEHYECKYVINAIPPTLTAKIHFRPELPAERNQLIQRLPM
GAVIKCMMYYKEAFWKKKDYCGCMIIEDEDAPISITLDDTKPDGSLPAIMGFILARKADR
LAKLHKEIRKKKICELYAKVLGSQEALHPVHYEEKNWCEEQYSGGCYTAYFPPGIMTQYG
RVIRQPVGRIFFAGTETATKWSGYMEGAVEAGERAAREVLNGLGKVTEKDIWVQEPESKD
VPAVEITHTFWERNLPSVSGLLKIIGFSTSVTALGFVLYKYKLLPRS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM179652
n/a
NameBDBM179652
Synonyms:US9676701, 23 5-(5-((trans)-2-aminocyclopropyl)pyridin-2-yl)-2-fluorophenol hydrochloride
TypeSmall organic molecule
Emp. Form.C14H13FN2O
Mol. Mass.244.2642
SMILESN[C@H]1C[C@@H]1c1ccc(nc1)-c1ccc(F)c(O)c1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: