| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Prostaglandin E2 receptor EP2 subtype |
|---|
| Ligand | BDBM180007 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Binding Assay |
|---|
| pH | 6±n/a |
|---|
| Ki | 4.40±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Shibakawa, N; Yoneda, K; Katsube, T; Kanda, T; Ito, K; Yamamoto, K; Iwase, N; Ushiyama, S Substituted biaryl compound US Patent US9676720 Publication Date 6/13/2017 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Prostaglandin E2 receptor EP2 subtype |
|---|
| Name: | Prostaglandin E2 receptor EP2 subtype |
|---|
| Synonyms: | PE2R2_HUMAN | PGE receptor EP2 subtype | PTGER2 | Prostaglandin E2 | Prostaglandin E2 receptor | Prostaglandin E2 receptor EP4 subtype | Prostanoid EP2 Receptor |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 39775.71 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P43116 |
|---|
| Residue: | 358 |
|---|
| Sequence: | MGNASNDSQSEDCETRQWLPPGESPAISSVMFSAGVLGNLIALALLARRWRGDVGCSAGR
RSSLSLFHVLVTELVFTDLLGTCLISPVVLASYARNQTLVALAPESRACTYFAFAMTFFS
LATMLMLFAMALERYLSIGHPYFYQRRVSRSGGLAVLPVIYAVSLLFCSLPLLDYGQYVQ
YCPGTWCFIRHGRTAYLQLYATLLLLLIVSVLACNFSVILNLIRMHRRSRRSRCGPSLGS
GRGGPGARRRGERVSMAEETDHLILLAIMTITFAVCSLPFTIFAYMNETSSRKEKWDLQA
LRFLSINSIIDPWVFAILRPPVLRLMRSVLCCRISLRTQDATQTSCSTQSDASKQADL
|
|
|
|---|
| BDBM180007 |
|---|
| n/a |
|---|
| Name | BDBM180007 |
|---|
| Synonyms: | US9676720, Comparative example 3 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H23FN4O4S |
|---|
| Mol. Mass. | 506.549 |
|---|
| SMILES | OC(=O)CNc1cccc(CN(Cc2ccc(cc2)-c2ccc(F)cc2)S(=O)(=O)c2cccnc2)n1 |
|---|
| Structure | 
|
|---|
Search and Browse
