| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Serine/threonine-protein kinase B-raf [416-766,V600E] |
|---|
| Ligand | BDBM313464 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | In Vitro Raf Activity Determination |
|---|
| IC50 | 59.3±n/a nM |
|---|
| Citation |  Aversa, RJ; Burger, MT; Dillon, MP; Dineen, Jr., TA; Lou, Y; Nishiguchi, GA; Ramurthy, S; Rico, AC; Rauniyar, V; Sendzik, M; Subramanian, S; Setti, LQ; Taft, BR; Tanner, HR; Wan, L Compounds and compositions as RAF kinase inhibitors US Patent US10167279 Publication Date 1/1/2019 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Serine/threonine-protein kinase B-raf [416-766,V600E] |
|---|
| Name: | Serine/threonine-protein kinase B-raf [416-766,V600E] |
|---|
| Synonyms: | B-Raf (V600E) | BRAF | BRAF1 | BRAF_HUMAN | RAFB1 |
|---|
| Type: | n/a |
|---|
| Mol. Mass.: | 39690.71 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | PV3849, from Invitrogen |
|---|
| Residue: | 351 |
|---|
| Sequence: | LQKSPGPQRERKSSSSSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGK
WHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGS
SLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDF
GLATEKSRWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLP
YSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIE
LLARSLPKIHRSASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGAFPVH
|
|
|
|---|
| BDBM313464 |
|---|
| n/a |
|---|
| Name | BDBM313464 |
|---|
| Synonyms: | N-(5'-(3-fluorooxetan-3- yl)-6'-methoxy-2- methyl-[3,3'-bipyridin]- 5-yl)-4- (trifluoromethyl)picolin- amide | US10167279, Example 83 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H18F4N4O3 |
|---|
| Mol. Mass. | 462.3969 |
|---|
| SMILES | COc1ncc(cc1C1(F)COC1)-c1cc(NC(=O)c2cc(ccn2)C(F)(F)F)cnc1C |
|---|
| Structure | 
|
|---|
Search and Browse
