Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCholinesterases
LigandBDBM10524
Substrate/CompetitorBDBM8959
Meas. Tech.Measurement of FBSAChE/EqBuChE Inhibitory Activity
pH8±n/a
Temperature298.15±n/a K
Ki 120±n/a nM
Citation Savini LCampiani GGaeta APellerano CFattorusso CChiasserini LFedorko JMSaxena A Novel and potent tacrine-related hetero- and homobivalent ligands for acetylcholinesterase and butyrylcholinesterase. Bioorg Med Chem Lett 11:1779-82 (2001) [PubMed]  Article
More Info.:Get all data from this article,  Inhibition_Run data,   Solution Info,  Assay Method
 
Cholinesterases
Name:Cholinesterases
Synonyms:AChE | Acetylcholinesterase (AChE) | Acetylcholinesterase (human AChE)
Type:Enzyme
Mol. Mass.:67792.70
Organism:Homo sapiens (Human)
Description:P22303
Residue:614
Sequence:
MRPPQCLLHTPSLASPLLLLLLWLLGGGVGAEGREDAELLVTVRGGRLRGIRLKTPGGPV
SAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFEGTEMWNPN
RELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSM
NYRVGAFGFLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASV
GMHLLSPPSRGLFHRAVLQSGAPNGPWATVGMGEARRRATQLAHLVGCPPGGTGGNDTEL
VACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDFHGLQVLVG
VVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPE
DPARLREALSDVVGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGY
EIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWANFARTGDPNEPRDPKAPQWPPYTAGAQQ
YVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSATDTLDEAERQWKAEFHRWSSYMVHWKN
QFDHYSKQDRCSDL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM10524
BDBM8959
NameBDBM10524
Synonyms:N-{6-[(6,8-dichloro-1,2,3,4-tetrahydroacridin-9-yl)sulfanyl]hexyl}-1,2,3,4-tetrahydroacridin-9-amine | tacrine heterobivalent compound 3h
TypeSmall organic molecule
Emp. Form.C32H35Cl2N3S
Mol. Mass.564.611
SMILESClc1cc(Cl)c2c(SCCCCCCNc3c4CCCCc4nc4ccccc34)c3CCCCc3nc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: