Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetButyrylcholinesterase (BChE)
LigandBDBM8961
Substrate/CompetitorBDBM8978
Meas. Tech.Measurement of FBSAChE/EqBuChE Inhibitory Activity
pH8±n/a
Temperature298.15±n/a K
Ki 7±n/a nM
Citation Savini LCampiani GGaeta APellerano CFattorusso CChiasserini LFedorko JMSaxena A Novel and potent tacrine-related hetero- and homobivalent ligands for acetylcholinesterase and butyrylcholinesterase. Bioorg Med Chem Lett 11:1779-82 (2001) [PubMed]  Article
More Info.:Get all data from this article,  Inhibition_Run data,   Solution Info,  Assay Method
 
Butyrylcholinesterase (BChE)
Name:Butyrylcholinesterase
Synonyms:BuChE | Butyrlcholinesterase (BuChE) | Butyrylcholine esterase | Butyrylcholinesterase | Butyrylcholinesterase (BuChE) | Butyrylcholinesterase (EqBuChE) | Carboxylic ester hydrolase | butyrylcholinesterase precursor
Type:Protein
Mol. Mass.:68842.83
Organism:Equus caballus (Horse)
Description:Q9N1N9
Residue:602
Sequence:
MQSWGTIICIRILLRFLLLWVLIGNSHTEEDIIITTKNGKVRGMNLPVLGGTVTAFLGIP
YAQPPLGRLRFKKPQSLTKWSNIWNATKYANSCYQNTDQSFPGFLGSEMWNPNTELSEDC
LYLNVWIPAPKPKNATVMIWIYGGGFQTGTSSLPVYDGKFLARVERVIVVSMNYRVGALG
FLALSENPEAPGNMGLFDQQLALQWVQKNIAAFGGNPRSVTLFGESAGAASVSLHLLSPR
SQPLFTRAILQSGSSNAPWAVTSLYEARNRTLTLAKRMGCSRDNETEMIKCLRDKDPQEI
LLNEVFVVPYDTLLSVNFGPTVDGDFLTDMPDTLLQLGQFKRTQILVGVNKDEGTAFLVY
GAPGFSKDNNSIITRKEFQEGLKIFFPRVSEFGRESILFHYMDWLDDQRAENYREALDDV
VGDYNIICPALEFTKKFSELGNDAFFYYFEHRSTKLPWPEWMGVMHGYEIEFVFGLPLER
RVNYTKAEEILSRSIMKRWANFAKYGNPNGTQSNSTRWPVFKSTEQKYLTLNTESPKVYT
KLRAQQCRFWTLFFPKVLELTGNIDEAEREWKAGFHRWNNYMMDWKNQFNDYTSKKESCS
DF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM8961
BDBM8978
NameBDBM8961
Synonyms:1,2,3,4-tetrahydro-9-acridinamine | 1,2,3,4-tetrahydroacridin-9-amine | 9-THA | 9-amino-1,2,3,4-tetrahydroacridine (THA) | CHEMBL1337960 | CHEMBL95 | Cognex | Tacrine | Tracine | US8999994, Tacrine | cid_1935 | tacrine.HCl
TypeSmall organic molecule
Emp. Form.C13H14N2
Mol. Mass.198.2637
SMILESNc1c2CCCCc2nc2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: