Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetIntermediate conductance calcium-activated potassium channel protein 4
LigandBDBM314285
Substrate/Competitorn/a
Meas. Tech.Electrophysiology Assay
IC50 15.0±n/a nM
Citation Green LWang H Oxazolidinone and imidazolidinone compounds US Patent  US9611232 Publication Date 4/4/2017  Article
More Info.:Get all data from this article,  Assay Method
 
Intermediate conductance calcium-activated potassium channel protein 4
Name:Intermediate conductance calcium-activated potassium channel protein 4
Synonyms:IK1 | IKCa1 | KCa4 | Putative Gardos channel | SK4
Type:PROTEIN
Mol. Mass.:47723.22
Organism:Homo sapiens (Human)
Description:ChEMBL_1361891
Residue:427
Sequence:
MGGDLVLGLGALRRRKRLLEQEKSLAGWALVLAGTGIGLMVLHAEMLWFGGCSWALYLFL
VKCTISISTFLLLCLIVAFHAKEVQLFMTDNGLRDWRVALTGRQAAQIVLELVVCGLHPA
PVRGPPCVQDLGAPLTSPQPWPGFLGQGEALLSLAMLLRLYLVPRAVLLRSGVLLNASYR
SIGALNQVRFRHWFVAKLYMNTHPGRLLLGLTLGLWLTTAWVLSVAERQAVNATGHLSDT
LWLIPITFLTIGYGDVVPGTMWGKIVCLCTGVMGVCCTALLVAVVARKLEFNKAEKHVHN
FMMDIQYTKEMKESAARVLQEAWMFYKHTRRKESHAARRHQRKLLAAINAFRQVRLKHRK
LREQVNSMVDISKMHMILYDLQQNLSSSHRALEKQIDTLAGKLDALTELLSTALGPRQLP
EPSQQSK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM314285
n/a
NameBDBM314285
Synonyms:US9611232, Example 17
TypeSmall organic molecule
Emp. Form.C23H19FN2O3
Mol. Mass.390.407
SMILESNC(=O)CN1[C@@H](c2ccccc2F)C(OC1=O)(c1ccccc1)c1ccccc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: