Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBDNF/NT-3 growth factors receptor (TRKB)
LigandBDBM164902
Substrate/Competitorn/a
Meas. Tech.TrkB Activity
IC50 0.200±n/a nM
Citation Kane, Jr. JLMatthews GMetz MKothe MLiu JScholte A Tropomyosin-related kinase (TRK) inhibitors US Patent  US9611265 Publication Date 4/4/2017
More Info.:Get all data from this article,  Assay Method
 
BDNF/NT-3 growth factors receptor (TRKB)
Name:Neurotrophic tyrosine kinase receptor
Synonyms:GP145-TrkB | NTRK2 | Neurotrophic tyrosine kinase receptor type 2 | TRKB | Trk-B | TrkB tyrosine kinase | Tropomyosin-related kinase B | Tropomyosin-related kinase B (TRKB) | Tyrosine kinase receptor B (Trk-B)
Type:Enzyme
Mol. Mass.:91996.87
Organism:Homo sapiens (Human)
Description:Q16620
Residue:822
Sequence:
MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEP
NSVDPENITEIFIANQKRLEIINEDDVEAYVGLRNLTIVDSGLKFVAHKAFLKNSNLQHI
NFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNES
SKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMYWDVGNLVSKHM
NETSHTQGSLRITNISSDDSGKQISCVAENLVGEDQDSVNLTVHFAPTITFLESPTSDHH
WCIPFTVKGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYT
LIAKNEYGKDEKQISAHFMGWPGIDDGANPNYPDVIYEDYGTAANDIGDTTNRSNEIPST
DVTDKTGREHLSVYAVVVIASVVGFCLLVMLFLLKLARHSKFGMKGPASVISNDDDSASP
LHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQLKPDTFVQHIKRHNIVL
KRELGEGAFGKVFLAECYNLCPEQDKILVAVKTLKDASDNARKDFHREAELLTNLQHEHI
VKFYGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMAEGNPPTELTQSQMLHIAQQI
AAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWM
PPESIMYRKFTTESDVWSLGVVLWEIFTYGKQPWYQLSNNEVIECITQGRVLQRPRTCPQ
EVYELMLGCWQREPHMRKNIKGIHTLLQNLAKASPVYLDILG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM164902
n/a
NameBDBM164902
Synonyms:US10166239, Ex. 3-16 | US9067914, Ex. 3-16
TypeSmall organic molecule
Emp. Form.C29H30N5O4P
Mol. Mass.543.5534
SMILESCOc1ccc(COc2ccc(Cn3c(N)nc4cc(cnc34)-c3ccc(nc3)P(C)(C)=O)cc2OC)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: