Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic anhydrase 1
LigandBDBM10897
Substrate/CompetitorBDBM10856
Meas. Tech.CA Inhibition Assay
Ki 14700±n/a nM
Citation Nishimori IMinakuchi TMorimoto KSano SOnishi STakeuchi HVullo DScozzafava ASupuran CT Carbonic anhydrase inhibitors: DNA cloning and inhibition studies of the alpha-carbonic anhydrase from Helicobacter pylori, a new target for developing sulfonamide and sulfamate gastric drugs. J Med Chem 49:2117-26 (2006) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Carbonic anhydrase 1
Name:Carbonic anhydrase
Synonyms:CA-I | CAB | Carbonate dehydratase I | Carbonic anhydrase 1 (CA I) | Carbonic anhydrase 1 (CA-I) | Carbonic anhydrase 1 (Recombinant CA I) | Carbonic anhydrase 2 (CA II) | Carbonic anhydrase B | Carbonic anhydrase I (CA I) | Carbonic anhydrase I (CA-I) | Carbonic anhydrase I (CAI) | Carbonic anhydrase I (hCA I) | Carbonic anhydrase isoenzyme I (hCA I) | hCA
Type:Enzyme
Mol. Mass.:28873.37
Organism:Homo sapiens (Human)
Description:P00915
Residue:261
Sequence:
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEI
INVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELH
VAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNF
DPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAV
PMQHNNRPTQPLKGRTVRASF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM10897
BDBM10856
NameBDBM10897
Synonyms:1-N-(4-tert-butylbenzene)benzene-1,2-disulfonamide | 2-(4-tert-Butylphenylsulfonamido)benzenesulfonamide | aromatic/heteroaromatic sulfonamide 31
TypeSmall organic molecule
Emp. Form.C16H20N2O4S2
Mol. Mass.368.471
SMILESCC(C)(C)c1ccc(cc1)S(=O)(=O)Nc1ccccc1S(N)(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: