Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic Anhydrase (hpCA)
LigandBDBM10868
Substrate/CompetitorBDBM10856
Meas. Tech.CA Inhibition Assay
Ki 323±n/a nM
Citation Nishimori IMinakuchi TMorimoto KSano SOnishi STakeuchi HVullo DScozzafava ASupuran CT Carbonic anhydrase inhibitors: DNA cloning and inhibition studies of the alpha-carbonic anhydrase from Helicobacter pylori, a new target for developing sulfonamide and sulfamate gastric drugs. J Med Chem 49:2117-26 (2006) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Carbonic Anhydrase (hpCA)
Name:Carbonic Anhydrase (hpCA)
Synonyms:hpCA
Type:Enzyme
Mol. Mass.:28277.52
Organism:Helicobacter pylori J99
Description:Q9ZK30
Residue:247
Sequence:
MKKTFLIALALTASLIGAENTKWDYKNKENGPHRWDKLHKDFEVCKSGKSQSPINIEHYY
HTQDKADLQFKYAASKPKAVFFTHHTLKASFEPTNHINYRGHDYVLDNVHFHAPMEFLIN
NKTRPLSAHFVHKDAKGRLLVLAIGFEEGKENPNLDPILEGIQKKQNLKEVALDAFLPKS
INYYHFNGSLTAPPCTEGVAWFVIEEPLEVSAKQLAEIKKRMKNSPNQRPVQPDYNTVII
KSSAETR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM10868
BDBM10856
NameBDBM10868
Synonyms:1,3,4-Thiadiazole-2-sulfonamide, 6 | 1,3,4-thiadiazole-2-sulfonamide 15 | 5-Amino-1,3,4-thiadiazole-2-sulphonamide (1) | 5-amino-1,3,4-thiadiazole-2-sulfonamide | CHEMBL265674 | aromatic/heteroaromatic sulfonamide 13
TypeSmall organic molecule
Emp. Form.C2H4N4O2S2
Mol. Mass.180.209
SMILESNc1nnc(s1)S(N)(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: