Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic Anhydrase (hpCA)
LigandBDBM10890
Substrate/CompetitorBDBM10856
Meas. Tech.CA Inhibition Assay
Ki 413±n/a nM
Citation Nishimori IMinakuchi TMorimoto KSano SOnishi STakeuchi HVullo DScozzafava ASupuran CT Carbonic anhydrase inhibitors: DNA cloning and inhibition studies of the alpha-carbonic anhydrase from Helicobacter pylori, a new target for developing sulfonamide and sulfamate gastric drugs. J Med Chem 49:2117-26 (2006) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Carbonic Anhydrase (hpCA)
Name:Carbonic Anhydrase (hpCA)
Synonyms:hpCA
Type:Enzyme
Mol. Mass.:28277.52
Organism:Helicobacter pylori J99
Description:Q9ZK30
Residue:247
Sequence:
MKKTFLIALALTASLIGAENTKWDYKNKENGPHRWDKLHKDFEVCKSGKSQSPINIEHYY
HTQDKADLQFKYAASKPKAVFFTHHTLKASFEPTNHINYRGHDYVLDNVHFHAPMEFLIN
NKTRPLSAHFVHKDAKGRLLVLAIGFEEGKENPNLDPILEGIQKKQNLKEVALDAFLPKS
INYYHFNGSLTAPPCTEGVAWFVIEEPLEVSAKQLAEIKKRMKNSPNQRPVQPDYNTVII
KSSAETR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM10890
BDBM10856
NameBDBM10890
Synonyms:1-N-(3-chloro-1H-indol-7-yl)benzene-1,4-disulfonamide | CHEMBL77517 | Compound 6 | E7070 | Indisulam (IND) | Sulfonamide, 7
TypeSmall organic molecule
Emp. Form.C14H12ClN3O4S2
Mol. Mass.385.846
SMILESNS(=O)(=O)c1ccc(cc1)S(=O)(=O)Nc1cccc2c(Cl)c[nH]c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: