Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCaM-kinase kinase beta
LigandBDBM317462
Substrate/Competitorn/a
Meas. Tech.Radioactivity Based Kinase Assay
IC50 728±n/a nM
Citation Zhu DBoylan JXu SRiggs JShi TWurmser AMikolon DDeyanat-Yazdi G Methods of treating a cancer using substituted pyrrolopyrimidine compounds, compositions thereof US Patent  US9623028 Publication Date 4/18/2017
More Info.:Get all data from this article,  Assay Method
 
CaM-kinase kinase beta
Name:CaM-kinase kinase beta
Synonyms:Calcium/calmodulin-dependent protein kinase kinase 2 (CaMKKB) | Calcium/calmodulin-dependent protein kinase kinase beta
Type:Enzyme Catalytic Domain
Mol. Mass.:64746.61
Organism:Homo sapiens (Human)
Description:gi_27437015
Residue:588
Sequence:
MSSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEP
GCAVDLGLARDRPLEADGQEVPLDTSGSQARPHLSGRKLSLQERSQGGLAAGGSLDMNGR
CICPSLPYSPVSSPQSSPRLPRRPTVESHHVSITGMQDCVQLNQYTLKDEIGKGSYGVVK
LAYNENDNTYYAMKVLSKKKLIRQAGFPRRPPPRGTRPAPGGCIQPRGPIEQVYQEIAIL
KKLDHPNVVKLVEVLDDPNEDHLYMVFELVNQGPVMEVPTLKPLSEDQARFYFQDLIKGI
EYLHYQKIIHRDIKPSNLLVGEDGHIKIADFGVSNEFKGSDALLSNTVGTPAFMAPESLS
ETRKIFSGKALDVWAMGVTLYCFVFGQCPFMDERIMCLHSKIKSQALEFPDQPDIAEDLK
DLITRMLDKNPESRIVVPEIKLHPWVTRHGAEPLPSEDENCTLVEVTEEEVENSVKHIPS
LATVILVKTMIRKRSFGNPFEGSRREERSLSAPGNLLTKKPTRECESLSELKEARQRRQP
PGHRPAPRGGGGSALVRGSPCVESCWAPAPGSPARMHPLRPEEAMEPE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM317462
n/a
NameBDBM317462
Synonyms:4-(4-(cyclopentyloxy)-5-(2- methylbenzo[d]oxazol-6-yl)-7H- pyrrolo[2,3-d]pyrimidin-2- ylamino)-3-methoxy-N- methylbenzamide | US9623028, Compound 38
TypeSmall organic molecule
Emp. Form.C28H28N6O4
Mol. Mass.512.5597
SMILESCNC(=O)c1ccc(Nc2nc(OC3CCCC3)c3c(c[nH]c3n2)-c2ccc3nc(C)oc3c2)c(OC)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: