Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDual specificity protein kinase TTK
LigandBDBM317466
Substrate/Competitorn/a
Meas. Tech.Radioactivity Based Kinase Assay
IC50 0.000±n/a nM
Citation Zhu DBoylan JXu SRiggs JShi TWurmser AMikolon DDeyanat-Yazdi G Methods of treating a cancer using substituted pyrrolopyrimidine compounds, compositions thereof US Patent  US9623028 Publication Date 4/18/2017
More Info.:Get all data from this article,  Assay Method
 
Dual specificity protein kinase TTK
Name:Dual specificity protein kinase TTK
Synonyms:Dual specificity protein kinase (TTK) | Dual specificity protein kinase TTK (MPS1) | MPS1 | Monopolar Spindle 1 (MPS1) | Monopolar Spindle 1 (Mps-1) | Monopolar Spindle 1 Kinase (MPS1) | Phosphotyrosine picked threonine-protein kinase (MPS1) | TTK
Type:Protein
Mol. Mass.:97086.79
Organism:Homo sapiens (Human)
Description:P33981
Residue:857
Sequence:
MESEDLSGRELTIDSIMNKVRDIKNKFKNEDLTDELSLNKISADTTDNSGTVNQIMMMAN
NPEDWLSLLLKLEKNSVPLSDALLNKLIGRYSQAIEALPPDKYGQNESFARIQVRFAELK
AIQEPDDARDYFQMARANCKKFAFVHISFAQFELSQGNVKKSKQLLQKAVERGAVPLEML
EIALRNLNLQKKQLLSEEEKKNLSASTVLTAQESFSGSLGHLQNRNNSCDSRGQTTKARF
LYGENMPPQDAEIGYRNSLRQTNKTKQSCPFGRVPVNLLNSPDCDVKTDDSVVPCFMKRQ
TSRSECRDLVVPGSKPSGNDSCELRNLKSVQNSHFKEPLVSDEKSSELIITDSITLKNKT
ESSLLAKLEETKEYQEPEVPESNQKQWQSKRKSECINQNPAASSNHWQIPELARKVNTEQ
KHTTFEQPVFSVSKQSPPISTSKWFDPKSICKTPSSNTLDDYMSCFRTPVVKNDFPPACQ
LSTPYGQPACFQQQQHQILATPLQNLQVLASSSANECISVKGRIYSILKQIGSGGSSKVF
QVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYM
VMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGML
KLIDFGIANQMQPDTTSVVKDSQVGTVNYMPPEAIKDMSSSRENGKSKSKISPKSDVWSL
GCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRI
SIPELLAHPYVQIQTHPVNQMAKGTTEEMKYVLGQLVGLNSPNSILKAAKTLYEHYSGGE
SHNSSSSKTFEKKRGKK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM317466
n/a
NameBDBM317466
Synonyms:4-(4-methoxy-5-(pyridin-4-yl)- 7H-pyrrolo[2,3-d]pyrimidin-2- ylamino)-N,N,3- trimethylbenzamide | US9623028, Compound 89
TypeSmall organic molecule
Emp. Form.C22H22N6O2
Mol. Mass.402.4491
SMILESCOc1nc(Nc2ccc(cc2C)C(=O)N(C)C)nc2[nH]cc(-c3ccncc3)c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: