BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistone lysine demethylase PHF8
LigandBDBM276044
Substrate/Competitorn/a
Meas. Tech.PHF8 Assay
IC50<100±n/a nM
Citation Chen YKNie ZStafford JAVeal JM Histone demethylase inhibitors US Patent  US10174003 Publication Date 1/8/2019  Article
More Info.:Get all data from this article,  Assay Method
 
Histone lysine demethylase PHF8
Name:Histone lysine demethylase PHF8
Synonyms:Histone lysine demethylase PHF8 (PHF8) | Lysine-specific demethylase 7A/7B | PHD finger protein 8
Type:Protein
Mol. Mass.:117889.91
Organism:Homo sapiens (Human)
Description:Q9UPP1
Residue:1060
Sequence:
MNRSRAIVQRGRVLPPPAPLDTTNLAGRRTLQGRAKMASVPVYCLCRLPYDVTRFMIECD
MCQDWFHGSCVGVEEEKAADIDLYHCPNCEVLHGPSIMKKRRGSSKGHDTHKGKPVKTGS
PTFVRELRSRTFDSSDEVILKPTGNQLTVEFLEENSFSVPILVLKKDGLGMTLPSPSFTV
RDVEHYVGSDKEIDVIDVTRQADCKMKLGDFVKYYYSGKREKVLNVISLEFSDTRLSNLV
ETPKIVRKLSWVENLWPEECVFERPNVQKYCLMSVRDSYTDFHIDFGGTSVWYHVLKGEK
IFYLIRPTNANLTLFECWSSSSNQNEMFFGDQVDKCYKCSVKQGQTLFIPTGWIHAVLTP
VDCLAFGGNFLHSLNIEMQLKAYEIEKRLSTADLFRFPNFETICWYVGKHILDIFRGLRE
NRRHPASYLVHGGKALNLAFRAWTRKEALPDHEDEIPETVRTVQLIKDLAREIRLVEDIF
QQNVGKTSNIFGLQRIFPAGSIPLTRPAHSTSVSMSRLSLPSKNGSKKKGLKPKELFKKA
ERKGKESSALGPAGQLSYNLMDTYSHQALKTGSFQKAKFNITGACLNDSDDDSPDLDLDG
NESPLALLMSNGSTKRVKSLSKSRRTKIAKKVDKARLMAEQVMEDEFDLDSDDELQIDER
LGKEKATLIIRPKFPRKLPRAKPCSDPNRVREPGEVEFDIEEDYTTDEDMVEGVEGKLGN
GSGAGGILDLLKASRQVGGPDYAALTEAPASPSTQEAIQGMLCMANLQSSSSSPATSSLQ
AWWTGGQDRSSGSSSSGLGTVSNSPASQRTPGKRPIKRPAYWRTESEEEEENASLDEQDS
LGACFKDAEYIYPSLESDDDDPALKSRPKKKKNSDDAPWSPKARVTPTLPKQDRPVREGT
RVASIETGLAAAAAKLAQQELQKAQKKKYIKKKPLLKEVEQPRPQDSNLSLTVPAPTVAA
TPQLVTSSSPLPPPEPKQEALSGSLADHEYTARPNAFGMAQANRSTTPMAPGVFLTQRRP
SVGSQSNQAGQGKRPKKGLATAKQRLGRILKIHRNGKLLL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM276044
n/a
NameBDBM276044
Synonyms:2-[1-[2-(2-chlorophenyl)ethyl]imidazol-4-yl]-4-(1H-triazol-4-yl)pyridine | US10071984, Example 6 | US10174003, Example 6
TypeSmall organic molecule
Emp. Form.C18H15ClN6
Mol. Mass.350.805
SMILESClc1ccccc1CCn1cnc(c1)-c1cc(ccn1)-c1c[nH]nn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: