| Reaction Details |
|---|
 | Report a problem with these data |
| Target | P2X purinoceptor 3 |
|---|
| Ligand | BDBM320136 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Intracellular Calcium Measurement to Assess Antagonist Activity at Human P2X3 and Human P2X2/3 Receptors |
|---|
| IC50 | 5.00±n/a nM |
|---|
| Citation |  Davenport, AJ; Bräuer, N; Fischer, OM; Rotgeri, A; Rottmann, A; Neagoe, I; Nagel, J; Godinho-Coelho, A; Klar, J 1,3-thiazol-2-yl substituted benzamides US Patent US10174016 Publication Date 1/8/2019 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| P2X purinoceptor 3 |
|---|
| Name: | P2X purinoceptor 3 |
|---|
| Synonyms: | ATP receptor | Glucocorticoid receptor | P2RX3 | P2RX3_HUMAN | P2X purinoceptor 3 | P2X purinoceptor 3 (P2RX3) | P2X purinoceptor 3 (P2X3) | P2X3 | P2X3 purinoceptor | Purinergic receptor | p2x3 + hsa |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 44292.02 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P56373 |
|---|
| Residue: | 397 |
|---|
| Sequence: | MNCISDFFTYETTKSVVVKSWTIGIINRVVQLLIISYFVGWVFLHEKAYQVRDTAIESSV
VTKVKGSGLYANRVMDVSDYVTPPQGTSVFVIITKMIVTENQMQGFCPESEEKYRCVSDS
QCGPERLPGGGILTGRCVNYSSVLRTCEIQGWCPTEVDTVETPIMMEAENFTIFIKNSIR
FPLFNFEKGNLLPNLTARDMKTCRFHPDKDPFCPILRVGDVVKFAGQDFAKLARTGGVLG
IKIGWVCDLDKAWDQCIPKYSFTRLDSVSEKSSVSPGYNFRFAKYYKMENGSEYRTLLKA
FGIRFDVLVYGNAGKFNIIPTIISSVAAFTSVGVGTVLCDIILLNFLKGADQYKAKKFEE
VNETTLKIAALTNPVYPSDQTTAEKQSTDSGAFSIGH
|
|
|
|---|
| BDBM320136 |
|---|
| n/a |
|---|
| Name | BDBM320136 |
|---|
| Synonyms: | 3-(5-methyl-1,3- thiazol-2-yl)-5-{[1- (2,2,2- trifluoroethyl) piperidin-4-yl]oxy}- N-{(1R)-1-[2- (trifluoromethyl) pyrimidin-5- yl]ethyl}benzamide | US10174016, Example 303 | US10202369, Example 310 | US10472354, Example 303 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H25F6N5O2S |
|---|
| Mol. Mass. | 573.554 |
|---|
| SMILES | C[C@@H](NC(=O)c1cc(OC2CCN(CC(F)(F)F)CC2)cc(c1)-c1ncc(C)s1)c1cnc(nc1)C(F)(F)F |r| |
|---|
| Structure | 
|
|---|
Search and Browse
