Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetcGMP-dependent 3',5'-cyclic phosphodiesterase
LigandBDBM320817
Substrate/Competitorn/a
Meas. Tech.Lab B PDE2 assay
Ki 0.044±n/a nM
Citation Shen DDwyer MPSinz CJWang DStachel SJPaone DVForster ABerger RChen YQian YXu SHu C Dihydropyrazolopyrimidinone compounds as PDE2 inhibitors US Patent  US10174037 Publication Date 1/8/2019
More Info.:Get all data from this article,  Assay Method
 
cGMP-dependent 3',5'-cyclic phosphodiesterase
Name:3',5'-cyclic phosphodiesterase
Synonyms:CGS-PDE | Cyclic GMP-stimulated phosphodiesterase | PDE2A | cGSPDE
Type:Protein
Mol. Mass.:105691.58
Organism:Homo sapiens (Human)
Description:O00408
Residue:941
Sequence:
MGQACGHSILCRSQQYPAARPAEPRGQQVFLKPDEPPPPPQPCADSLQDALLSLGSVIDI
SGLQRAVKEALSAVLPRVETVYTYLLDGESQLVCEDPPHELPQEGKVREAIISQKRLGCN
GLGFSDLPGKPLARLVAPLAPDTQVLVMPLADKEAGAVAAVILVHCGQLSDNEEWSLQAV
EKHTLVALRRVQVLQQRGPREAPRAVQNPPEGTAEDQKGGAAYTDRDRKILQLCGELYDL
DASSLQLKVLQYLQQETRASRCCLLLVSEDNLQLSCKVIGDKVLGEEVSFPLTGCLGQVV
EDKKSIQLKDLTSEDVQQLQSMLGCELQAMLCVPVISRATDQVVALACAFNKLEGDLFTD
EDEHVIQHCFHYTSTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITE
ARNLSNAEICSVFLLDQNELVAKVFDGGVVDDESYEIRIPADQGIAGHVATTGQILNIPD
AYAHPLFYRGVDDSTGFRTRNILCFPIKNENQEVIGVAELVNKINGPWFSKFDEDLATAF
SIYCGISIAHSLLYKKVNEAQYRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDSNF
ASFTYTPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMH
AFSVSHFCYLLYKNLELTNYLEDIEIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYS
SEGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDL
QKMAEVGYDRNNKQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAM
GNRPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSH
KFTIRGLPSNNSLDFLDEEYEVPDLDGTRAPINGCCSLDAE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM320817
n/a
NameBDBM320817
Synonyms:(R)- or (S)-6-(Dimethylamino)-1-(1-(3- fluoro-4-(trifluoromethyl)phenyl)propyl)-3- (fluoromethyl)-1H-pyrazolo[3,4- d]pyrimidin-4(5H)-one | US10174037, Example 222 | US10174037, Example 223
TypeSmall organic molecule
Emp. Form.C18H18F5N5O
Mol. Mass.415.3604
SMILESCCC(c1ccc(c(F)c1)C(F)(F)F)n1nc(CF)c2c1nc([nH]c2=O)N(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: